[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : nrdC.11
DDBJ      :nrdC.11      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:324 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->137 PF10127 * Nuc-transf 6e-16 34.6 %
:HMM:PFM   3->135 PF10127 * Nuc-transf 1.6e-19 20.2 124/247  
:BLT:SWISS 3->322 Y05G_BPT4 2e-81 52.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81399.1 GT:GENE nrdC.11 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(46547..47521) GB:FROM 46547 GB:TO 47521 GB:DIRECTION - GB:GENE nrdC.11 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049709.1; T4 gene synonym: tk.-11 GB:PROTEIN_ID AAQ81399.1 GB:DB_XREF GI:34732861 GB:GENE:GENE nrdC.11 LENGTH 324 SQ:AASEQ MQKVIFEGLHGSHLYGLNTPESDLDMKGIFIPDPKDILLSQVKSSYSITTGNDKSKNSKDDIDIEMFTLKQFIHECVKGETAALDMLHTPTDKIVSDSAIWQFIQSQRSSFYTTNMTSYMSYVMKQAAKYGVKGSRLAALRQVKDFMDALQIHENPRLRELKIPLPSNEFCFWTVDREKPETNSYYTMMGRKYMAGVKIAEFAGAVDKLWNEYGERARKAEANEGIDWKALSHAMRGGLQLLEIYQTGDLKYPLANAEEIKLVKAGELPFKEVQARLEQIVDDVDAAAKEAGRNGMPSAVNVEPWNQFVLDVYSDAMLEYLKNR GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 3->322|Y05G_BPT4|2e-81|52.5|320/336| SEG 52->64|ndksknskddidi| RP:PFM:NREP 1 RP:PFM:REP 3->137|PF10127|6e-16|34.6|127/214|Nuc-transf| HM:PFM:NREP 1 HM:PFM:REP 3->135|PF10127|1.6e-19|20.2|124/247|Nuc-transf| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,46-60,323-325| PSIPRED ccEEEEEEEcccEEEccccccccccEEEEEcccHHHEEEcccccccEEEcccccccccccccEEEEHHHHHHHHHHHccccEEEEEcccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcc //