[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : nrdC.2
DDBJ      :nrdC.2       hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   56->100 PF05129 * Elf1 7e-08 26.7 45/81  
:BLT:SWISS 54->97 Y04N_BPT4 7e-08 43.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81379.1 GT:GENE nrdC.2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(36568..36879) GB:FROM 36568 GB:TO 36879 GB:DIRECTION - GB:GENE nrdC.2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049700.1; NrdC.2 GB:PROTEIN_ID AAQ81379.1 GB:DB_XREF GI:34732841 GB:GENE:GENE nrdC.2 LENGTH 103 SQ:AASEQ MDIELHNEAQKQIRDMEWAIRSANIAKFRELRISEKSVSDAISNYHLSNEYDEILARRKAVADQHFKCPLCDTEQIQLVSWQHKVVDLRCRRCKHKFIWESPV GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 54->97|Y04N_BPT4|7e-08|43.2|44/104| HM:PFM:NREP 1 HM:PFM:REP 56->100|PF05129|7e-08|26.7|45/81|Elf1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-7| PSIPRED ccccHHHHHHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcccEEEEEHHHHHHHHccccc //