[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : pseT.2
DDBJ      :pseT.2       hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->71 PF02999 * Borrelia_orfD 0.00033 31.7 60/117  
:BLT:SWISS 4->73 Y13J_BPT4 8e-05 36.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81519.1 GT:GENE pseT.2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(135201..135449) GB:FROM 135201 GB:TO 135449 GB:DIRECTION - GB:GENE pseT.2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049836.2; PseT.2 GB:PROTEIN_ID AAQ81519.1 GB:DB_XREF GI:34732982 GB:GENE:GENE pseT.2 LENGTH 82 SQ:AASEQ MTSMKHIGIVLLSLLVMSCAAKPKELPTPQPVHKLEVTWKATTEGATLSFEDYNRLGVWLEDVNRYIKDQKAIIQICEGRIR GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 4->73|Y13J_BPT4|8e-05|36.2|69/99| TM:NTM 1 TM:REGION 1->22| HM:PFM:NREP 1 HM:PFM:REP 10->71|PF02999|0.00033|31.7|60/117|Borrelia_orfD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,82-83| PSIPRED cccHHHHHHHHHHHHHHHHcccHHHcccccccEEEEEEEEEcccccEEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccc //