[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : pseT.3
DDBJ      :pseT.3       conserved hypothetical predicted membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->97 PF10828 * DUF2570 1.6e-06 24.1 79/110  
:BLT:SWISS 37->105 GBP2_RAT 9e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81520.1 GT:GENE pseT.3 GT:PRODUCT conserved hypothetical predicted membrane protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(135446..135763) GB:FROM 135446 GB:TO 135763 GB:DIRECTION - GB:GENE pseT.3 GB:PRODUCT conserved hypothetical predicted membrane protein GB:NOTE similar to T4 accession NP_049837.1; PseT.3 GB:PROTEIN_ID AAQ81520.1 GB:DB_XREF GI:34732983 GB:GENE:GENE pseT.3 LENGTH 105 SQ:AASEQ MLPSLSSTISWLRNNVLYMIIIGLLGWTIKNQSEQIDNLETKIETIQKFQVSSVENAKPVQEAMLKAPKATRQMEKIAEKKPQLLEKHMNTGFRQLTDKIQETTK GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 37->105|GBP2_RAT|9e-04|33.3|69/589| HM:PFM:NREP 1 HM:PFM:REP 14->97|PF10828|1.6e-06|24.1|79/110|DUF2570| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,68-81,101-106| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcc //