[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : rI
DDBJ      :rI           lysis inhibition regulator membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81409.1 GT:GENE rI GT:PRODUCT lysis inhibition regulator membrane protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(51743..52027) GB:FROM 51743 GB:TO 52027 GB:DIRECTION - GB:GENE rI GB:PRODUCT lysis inhibition regulator membrane protein GB:FUNCTION acts in concert with phage t holin protein for lysis timing GB:NOTE similar to T4 accession NP_049717.1; T4 gene synonyms: mobD.8, tk.-2; rI GB:PROTEIN_ID AAQ81409.1 GB:DB_XREF GI:34732871 GB:GENE:GENE rI LENGTH 94 SQ:AASEQ MPKIIAAVALLVATVHLVSANPEVGSYDEFMQGAMIVYTNDITHSKDNSVQFLEYLDTKWGSAGCSDTCFQLGYQEAKLFVAYNTEVQNGNKIQ GT:EXON 1|1-94:0| TM:NTM 1 TM:REGION 1->22| SEG 6->18|aavallvatvhlv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,89-95| PSIPRED ccHHHHHHHHHHHHHHHEEcccccccHHHHHcccEEEEEcccccccccHHHHHHHHHHcccccccHHHHHHccccEEEEEEEEEcccccccccc //