[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : rI.-1
DDBJ      :rI.-1        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
a.25.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   14->115 2chpC PDBj 5e-04 21.3 %
:RPS:SCOP  31->118 2fjcA1  a.25.1.1 * 1e-04 21.2 %
:BLT:SWISS 3->125 Y05O_BPT4 4e-16 37.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81408.1 GT:GENE rI.-1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(51382..51762) GB:FROM 51382 GB:TO 51762 GB:DIRECTION - GB:GENE rI.-1 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049716.1; T4 gene synonyms: tk.-3 and tk.-4, mobD.6; MobD.6 GB:PROTEIN_ID AAQ81408.1 GB:DB_XREF GI:34732870 GB:GENE:GENE rI.-1 LENGTH 126 SQ:AASEQ MEIKFSDVVKSPTNIFDEFIGACLVSSVMAHSAHFETKSYEKHVAFEYFYDEMPDKIDTFAETYMASGFNYSPTLKIPNVDFTGFVKRLAELAEEVATKSPNGVLKNAADDIQQLCRLTLYKLSLS GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 3->125|Y05O_BPT4|4e-16|37.5|120/128| RP:PDB:NREP 1 RP:PDB:REP 14->115|2chpC|5e-04|21.3|94/145| RP:SCP:NREP 1 RP:SCP:REP 31->118|2fjcA1|1e-04|21.2|80/151|a.25.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 74.6 SQ:SECSTR #############HHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT#######ccccccHHHHHH#HcccccccccccHHHHHHHHHHHHHHH########### DISOP:02AL 1-5| PSIPRED ccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccc //