[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : regA
DDBJ      :regA         translational repressor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
d.58.27
:118 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->118 1regX PDBj 6e-35 57.6 %
:RPS:SCOP  1->118 1regX  d.58.27.1 * 5e-53 57.6 %
:HMM:SCOP  1->119 1regX_ d.58.27.1 * 8.9e-58 65.5 %
:RPS:PFM   1->118 PF01818 * Translat_reg 7e-45 66.1 %
:HMM:PFM   1->118 PF01818 * Translat_reg 1.1e-57 60.2 118/121  
:BLT:SWISS 1->118 REGA_BPR69 8e-38 63.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81356.1 GT:GENE regA GT:PRODUCT translational repressor protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(22761..23117) GB:FROM 22761 GB:TO 23117 GB:DIRECTION - GB:GENE regA GB:PRODUCT translational repressor protein GB:FUNCTION regulates translation of mRNAs for DNA replication proteins and other early gene products GB:NOTE similar to T4 accession NP_049663.1; RegA GB:PROTEIN_ID AAQ81356.1 GB:DB_XREF GI:34732818 GB:GENE:GENE regA LENGTH 118 SQ:AASEQ MIPIDIAHPDDFLKIAETLTRIGIASNKEKKLYQSCHILQKQGKYFIVHFKEMLQLDGLKVDISDEDIGRRNNIAMLLNSWKLCTILEPIDVSSHNNFRVISHKQKADWTLIAKYKFG GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 1->118|REGA_BPR69|8e-38|63.6|118/122| BL:PDB:NREP 1 BL:PDB:REP 1->118|1regX|6e-35|57.6|118/122| RP:PFM:NREP 1 RP:PFM:REP 1->118|PF01818|7e-45|66.1|118/120|Translat_reg| HM:PFM:NREP 1 HM:PFM:REP 1->118|PF01818|1.1e-57|60.2|118/121|Translat_reg| GO:PFM:NREP 1 GO:PFM GO:0003723|"GO:RNA binding"|PF01818|IPR002702| RP:SCP:NREP 1 RP:SCP:REP 1->118|1regX|5e-53|57.6|118/122|d.58.27.1| HM:SCP:REP 1->119|1regX_|8.9e-58|65.5|119/0|d.58.27.1|1/1|Translational regulator protein regA| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 100.0 SQ:SECSTR cEEEEcccTTHHHHHHHHHHTEEEEETTTTEEEEcEEEEEETTEEEEEEHHHHHHHTTccccccHHHHHHHHHHHHHHHHTTccEEccccccccccccEEccTTTGGGcEEEETTTcc PSIPRED cEEEEEccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEHHHHHHHccccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEEccccccEEEEEEEcc //