[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : regB
DDBJ      :regB         site-specific RNA endonuclease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->147 2hx6A PDBj 4e-29 45.8 %
:RPS:PDB   26->146 2eadB PDBj 2e-04 10.4 %
:RPS:PFM   1->135 PF10715 * REGB_T4 1e-16 38.3 %
:HMM:PFM   2->144 PF10715 * REGB_T4 2.7e-49 38.3 141/150  
:BLT:SWISS 1->147 REGB_BPT4 8e-30 46.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81427.1 GT:GENE regB GT:PRODUCT site-specific RNA endonuclease GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(59884..60333) GB:FROM 59884 GB:TO 60333 GB:DIRECTION - GB:GENE regB GB:PRODUCT site-specific RNA endonuclease GB:FUNCTION cleaves a subset of T4 mRNAs at GGAG using r-protein S1 for recognition GB:NOTE similar to T4 accession NP_049726.1; RegB GB:PROTEIN_ID AAQ81427.1 GB:DB_XREF GI:34732889 GB:GENE:GENE regB LENGTH 149 SQ:AASEQ MNRYKLRRVLEDKFKEINSRIEASRNTRQGSHKFHLEYTYHFIDDLIIRKIDVDYVLQLVNRIDDHLDAIDEHMSLPYPPTLDLKRDDQVQYRPIRLEITDGNLWIGLTTSKIPPSGEYSSAITCRMAIVNSRRLSSNVTTRVIKVEGL GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 1->147|REGB_BPT4|8e-30|46.5|144/153| BL:PDB:NREP 1 BL:PDB:REP 1->147|2hx6A|4e-29|45.8|144/153| RP:PDB:NREP 1 RP:PDB:REP 26->146|2eadB|2e-04|10.4|115/884| RP:PFM:NREP 1 RP:PFM:REP 1->135|PF10715|1e-16|38.3|133/159|REGB_T4| HM:PFM:NREP 1 HM:PFM:REP 2->144|PF10715|2.7e-49|38.3|141/150|REGB_T4| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 98.7 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEETTTTEEEEEEEETHHHTcTTEEEEEEEEEETTTTEEEEEEEEccTTcEEEEEEccccTTccEEEEEEEEETTEEEEEEEETTTccEEEEEEEEEEcTTccEEEEcTTcccEEEEc## DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEEcccEEEEEEEEcccccccccccEEEEEEEEccccccccccEEEEEEEcc //