[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : rnh
DDBJ      :rnh          RNaseH ribonuclease
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  7/175   --->[See Alignment]
a.60.7c.120.1
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->307 2ihnA PDBj 3e-69 44.8 %
:RPS:PDB   20->208 1bgxT PDBj 8e-10 22.0 %
:RPS:SCOP  18->190 1exnA2  c.120.1.2 * 2e-20 19.6 %
:RPS:SCOP  185->307 1tfrA1  a.60.7.1 * 6e-37 42.3 %
:HMM:SCOP  15->190 1xo1A2 c.120.1.2 * 1.5e-34 24.7 %
:HMM:SCOP  185->307 1tfrA1 a.60.7.1 * 1.5e-50 56.1 %
:RPS:PFM   20->163 PF02739 * 5_3_exonuc_N 3e-06 27.6 %
:RPS:PFM   185->307 PF09293 * RNaseH_C 2e-32 57.4 %
:HMM:PFM   185->307 PF09293 * RNaseH_C 3.5e-58 59.8 122/122  
:HMM:PFM   55->174 PF02739 * 5_3_exonuc_N 8.5e-16 29.6 108/169  
:BLT:SWISS 1->307 RNH_BPT4 2e-72 44.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81536.1 GT:GENE rnh GT:PRODUCT RNaseH ribonuclease GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(144297..145220) GB:FROM 144297 GB:TO 145220 GB:DIRECTION - GB:GENE rnh GB:PRODUCT RNaseH ribonuclease GB:FUNCTION DNA replication enzyme for processing of Okazaki fragment RNA primers GB:NOTE similar to T4 accession NP_049859.1; T4 gene synonym: das; Rnh GB:PROTEIN_ID AAQ81536.1 GB:DB_XREF GI:34732999 GB:GENE:GENE rnh LENGTH 307 SQ:AASEQ MNLDSFMGEAEKTGGPDVNIIDASQLIIATVMANFEPDEVNEAMLRHLIFDTMRNNVKKFKAEYPETIIAFDDSKDGYWRRDLAWYYKKNRSISKEESKWDWDALFGFINKIVDEMLTVYPGVKMIKIGKTEADDIIAILTKLFTDQGRCVMISSSDSDFTQLHKFKGVKQYSPAQKKSVKPKNGSPKHDLFYKIIKGDGKDGVAGIKCRSTYVIDRVEGERAPPCSAKWIESLVQSEDPRAALENEEWQKRWDENVKLLDLSQIPDHVAEKILTSYNNCTVNPRGKLYSYFVKNRLTKLLTKVNQF GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 1->307|RNH_BPT4|2e-72|44.9|303/305| BL:PDB:NREP 1 BL:PDB:REP 1->307|2ihnA|3e-69|44.8|297/299| RP:PDB:NREP 1 RP:PDB:REP 20->208|1bgxT|8e-10|22.0|177/828| RP:PFM:NREP 2 RP:PFM:REP 20->163|PF02739|3e-06|27.6|134/165|5_3_exonuc_N| RP:PFM:REP 185->307|PF09293|2e-32|57.4|122/122|RNaseH_C| HM:PFM:NREP 2 HM:PFM:REP 185->307|PF09293|3.5e-58|59.8|122/122|RNaseH_C| HM:PFM:REP 55->174|PF02739|8.5e-16|29.6|108/169|5_3_exonuc_N| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF02739|IPR020046| GO:PFM GO:0008409|"GO:5'-3' exonuclease activity"|PF02739|IPR020046| RP:SCP:NREP 2 RP:SCP:REP 18->190|1exnA2|2e-20|19.6|163/166|c.120.1.2| RP:SCP:REP 185->307|1tfrA1|6e-37|42.3|123/123|a.60.7.1| HM:SCP:REP 15->190|1xo1A2|1.5e-34|24.7|166/167|c.120.1.2|1/1|PIN domain-like| HM:SCP:REP 185->307|1tfrA1|1.5e-50|56.1|123/123|a.60.7.1|1/1|5' to 3' exonuclease, C-terminal subdomain| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 99.0 SQ:SECSTR cccccccccccccE###EEcccccTHHHHTTcccTTcccccccccccTTHHHHHHHGGGTcccccEEccccccccccGcccGGGGTTTcccccccTTcTTGGGTHHHHHHHTccHHEEEEETccccccccccHHHHHHHHHHHHHHHTcccccccccTTccTTccTTccccccccccTTHHHHTccGGGTTTTTTcccccccccccccccTTcHHHccTTcccccccHHHHHHHHHcGGGHHHHccHHHHHHHHHHHHHHcGGGccHHHHHHHHHHHHTcccccTTTTHHHHHHHTcTTTTTccTTc DISOP:02AL 5-7| PSIPRED ccHHHHccccHHccccEEEEEEccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHccccEEEEcccccHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHcc //