[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : rpbA
DDBJ      :rpbA         RNA polymerase binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->116 PF10789 * Phage_RpbA 1e-17 49.5 %
:HMM:PFM   11->117 PF10789 * Phage_RpbA 5.6e-45 50.0 106/108  
:BLT:SWISS 12->113 RPBA_BPT4 6e-04 28.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81360.1 GT:GENE rpbA GT:PRODUCT RNA polymerase binding protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(25462..25815) GB:FROM 25462 GB:TO 25815 GB:DIRECTION - GB:GENE rpbA GB:PRODUCT RNA polymerase binding protein GB:NOTE similar to T4 accession NP_049667.1; T4 gene synonym: 45.1; RpbA GB:PROTEIN_ID AAQ81360.1 GB:DB_XREF GI:34732822 GB:GENE:GENE rpbA LENGTH 117 SQ:AASEQ MRNQAIVVVPADIRPLSDNIYETSVKIRKAWVANISDVRANQLQAIEQSVRFELYAEIDNLVRDMYVDLLQRRRAMILANGGYHVKGMNDKPVFAKQFQYDTDELIITAAEMVMADY GT:EXON 1|1-117:0| BL:SWS:NREP 1 BL:SWS:REP 12->113|RPBA_BPT4|6e-04|28.6|98/129| RP:PFM:NREP 1 RP:PFM:REP 11->116|PF10789|1e-17|49.5|103/104|Phage_RpbA| HM:PFM:NREP 1 HM:PFM:REP 11->117|PF10789|5.6e-45|50.0|106/108|Phage_RpbA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccEEEEEEcccEEcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHEEcccccccccccccccHHHHHHHHHHHHHHcc //