[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : t
DDBJ      :t            holin lysis mediator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->221 PF11031 * Phage_holin_T 3e-74 60.3 %
:HMM:PFM   9->221 PF11031 * Phage_holin_T 2.4e-108 59.6 213/216  
:BLT:SWISS 18->221 VLYS_BPK3 4e-60 48.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81542.1 GT:GENE t GT:PRODUCT holin lysis mediator GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 155962..156627 GB:FROM 155962 GB:TO 156627 GB:DIRECTION + GB:GENE t GB:PRODUCT holin lysis mediator GB:FUNCTION pore protein for T4 e lysozyme, controlling lysis timing and lysis inhibition, functions with rI protein GB:NOTE similar to T4 accession NP_049865.1; T4 gene synonyms: rV, stII; t GB:PROTEIN_ID AAQ81542.1 GB:DB_XREF GI:34733005 GB:GENE:GENE t LENGTH 221 SQ:AASEQ MSNQPTKTENQTGGRAGVLMDILDRLFKDAVTGEIVFYRAILLTLVFLMGFSWYSKEEIFALYKETRFENYQEILQAERDRKFEMAAQEQLQIAHVSSRADFSVVFSFRPRNMNYFVDMMATEGKTPTDLIGREKGGYPINKTSNEYMVHMSGRHFSNYKEFAYLPAGHEDFEYMYSCPITNLDNIYAGSVSMFWKKKPVINENKLFVICNQAERLLSRAR GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 18->221|VLYS_BPK3|4e-60|48.5|204/218| TM:NTM 1 TM:REGION 32->53| RP:PFM:NREP 1 RP:PFM:REP 18->221|PF11031|3e-74|60.3|204/215|Phage_holin_T| HM:PFM:NREP 1 HM:PFM:REP 9->221|PF11031|2.4e-108|59.6|213/216|Phage_holin_T| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1------------------------------------------------------------------------------------------------------------------------1-------------- DISOP:02AL 1-12,219-222| PSIPRED ccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHEEEccccEEEEEEEccccHHHHHHHHHHcccccccHHHHHHccccccccHHHHHHHcccccEEccccEEEcccccccEEEEEEccccccccEEEEEEEEEEcccccccHHHHHHHHcHHHHHHHHcc //