[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : tk
DDBJ      :tk           thymidine kinase
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  343/915 : Eukaryota  5/199 : Viruses  6/175   --->[See Alignment]
c.37.1g.39.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->181 2orwB PDBj 8e-13 31.4 %
:RPS:PDB   13->186 3e2iA PDBj 4e-18 23.5 %
:RPS:SCOP  8->110 1oftA  c.37.1.22 * 6e-06 13.6 %
:RPS:SCOP  143->191 2b8tA2  g.39.1.14 * 9e-15 30.6 %
:HMM:SCOP  1->140 2b8tA1 c.37.1.24 * 3.9e-37 38.1 %
:HMM:SCOP  141->191 2b8tA2 g.39.1.14 * 4.8e-12 41.2 %
:RPS:PFM   2->184 PF00265 * TK 2e-38 46.7 %
:HMM:PFM   3->184 PF00265 * TK 4.3e-48 31.2 173/176  
:BLT:SWISS 1->186 KITH_IDILO 6e-51 50.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81419.1 GT:GENE tk GT:PRODUCT thymidine kinase GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(56544..57119) GB:FROM 56544 GB:TO 57119 GB:DIRECTION - GB:GENE tk GB:PRODUCT thymidine kinase GB:NOTE similar to T4 accession NP_049719.1; Tk GB:PROTEIN_ID AAQ81419.1 GB:DB_XREF GI:34732881 GB:GENE:GENE tk LENGTH 191 SQ:AASEQ MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHMISQDDNLKAFCEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSNGHLFPASAELLVLAERKVEHETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVCRRHWKEGKIQK GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 1->186|KITH_IDILO|6e-51|50.5|186/193| BL:PDB:NREP 1 BL:PDB:REP 11->181|2orwB|8e-13|31.4|153/173| RP:PDB:NREP 1 RP:PDB:REP 13->186|3e2iA|4e-18|23.5|153/170| RP:PFM:NREP 1 RP:PFM:REP 2->184|PF00265|2e-38|46.7|182/184|TK| HM:PFM:NREP 1 HM:PFM:REP 3->184|PF00265|4.3e-48|31.2|173/176|TK| GO:PFM:NREP 2 GO:PFM GO:0004797|"GO:thymidine kinase activity"|PF00265|IPR001267| GO:PFM GO:0005524|"GO:ATP binding"|PF00265|IPR001267| RP:SCP:NREP 2 RP:SCP:REP 8->110|1oftA|6e-06|13.6|103/119|c.37.1.22| RP:SCP:REP 143->191|2b8tA2|9e-15|30.6|49/67|g.39.1.14| HM:SCP:REP 1->140|2b8tA1|3.9e-37|38.1|139/0|c.37.1.24|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 141->191|2b8tA2|4.8e-12|41.2|51/0|g.39.1.14|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 362 OP:NHOMOORG 361 OP:PATTERN ------------------11--1----------------------------------1111------- ----1---------------------------------------11111111111111--111111-111-------------------------------------------------------------------------------------------------------------------------1-----------------1-11----1---1---1111111--11111111111111-----1111-11111111111111111111111111111111111111111111111111111111211111111--1-1-------1-1----11111--1----------------11-------1-------------------------------------------1--1111111111-1--111111----111----------------------------------------------11111----------------------------------------------1---------1-------------------------------------------------------------------------11-1--111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111--111111111----1111111111111111-----------------------------111111111-111111111111111111111111---------------------------------1----------11-1111--1111111--- --11------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1----------1---------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 98.4 SQ:SECSTR ###EEEEEccTTccHHHHHHHHHHHHHHTTccEEEEEEcccTTcccccccHHHHHHHHHHEcEEEEEccGGGGGcccTTccEEEEccGGGccTHHHHHHHHHHHTHTcEEEEEEEEEEEccTTcccTTHHHHHccEEEEEcEEcTTccEEcEEEEEETTEEccTcccccccccEEEEEEcGGGcccHHTcc DISOP:02AL 188-192| PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEcccccccEEEcccccEEEEEcccHHHHHHHHHHHHHcccccEEEEEcHHcccHHHHHHHHHHHHHcccEEEEEEcccHHcccccccHHHHHHHHcEEEEEEEEEEccccccEEEEEEcccccEEccEEEEcccccEEEcHHHHcccccccc //