Bacteriophage 44RR2.8t (bp441)
Gene : tk.4
DDBJ      :tk.4         hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  1/199 : Viruses  6/175   --->[See Alignment]
:162 amino acids
:BLT:PDB   3->158 2jycA PDBj 8e-06 28.5 %
:RPS:PDB   2->148 2acfD PDBj 1e-11 10.5 %
:RPS:SCOP  92->160 1rw9A1  a.102.3.2 * 3e-12 19.1 %
:HMM:SCOP  2->160 2fg1A1 c.50.1.2 * 1.5e-30 28.7 %
:HMM:PFM   24->142 PF01661 * Macro 0.00026 12.2 115/118  
:BLT:SWISS 1->159 Y06D_BPT4 5e-20 34.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81423.1 GT:GENE tk.4 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(58095..58583) GB:FROM 58095 GB:TO 58583 GB:DIRECTION - GB:GENE tk.4 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049723.1; Tk.4 GB:PROTEIN_ID AAQ81423.1 GB:DB_XREF GI:34732885 GB:GENE:GENE tk.4 LENGTH 162 SQ:AASEQ MIVQYVKGNAISLFLEGKYDIFGHGCNIFNRMGSGIAKEVRERLPQLYVMDLKTVSGDRNKLGTIQAALINVEGRTSCGVNMYTQATFWDPTDMLSYDAVRSTFTMLNDSVAETSVGGSNMTMCIPMIGAGLARGDWSKISAIIDEVTPNIDITVVEFDGSK GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 1->159|Y06D_BPT4|5e-20|34.4|151/155| BL:PDB:NREP 1 BL:PDB:REP 3->158|2jycA|8e-06|28.5|137/152| RP:PDB:NREP 1 RP:PDB:REP 2->148|2acfD|1e-11|10.5|133/179| HM:PFM:NREP 1 HM:PFM:REP 24->142|PF01661|0.00026|12.2|115/118|Macro| RP:SCP:NREP 1 RP:SCP:REP 92->160|1rw9A1|3e-12|19.1|68/369|a.102.3.2| HM:SCP:REP 2->160|2fg1A1|1.5e-30|28.7|150/0|c.50.1.2|1/1|Macro domain-like| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- -----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------1-1-1----------------------------------------------------------------------------------------------------------------------------1---------- STR:NPRED 161 STR:RPRED 99.4 SQ:SECSTR TcEEEEEccHHHHHHHHcccEEEEEccTTcccccHHHHHHHHHTTTHHHHHHHHHHHHHccccTTcEEEEEcTTTccEEEEEccccGGGTccTTHHHHHHHGGGGcHHHccEccEEEHGccEEEEccTTcGGGcccHHHHHHHHHHHcccccEEEEEccHH# DISOP:02AL 162-163| PSIPRED ccEEEEEccHHHHccccccEEEEEEEEccccccHHHHHHHHHHccHHHHHHHHHHcccccccccEEEEEEEEcccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEcccccccccccHHHHHHHHHHHcccccEEEEEEcccc //