[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : uvsW.1
DDBJ      :uvsW.1       hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:76 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->61 2jpnA PDBj 4e-24 77.0 %
:RPS:PFM   20->61 PF11637 * UvsW 4e-12 90.5 %
:HMM:PFM   20->73 PF11637 * UvsW 2.3e-32 72.2 54/54  
:BLT:SWISS 1->61 UVSW_BPT4 1e-23 77.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81493.1 GT:GENE uvsW.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 114768..114998 GB:FROM 114768 GB:TO 114998 GB:DIRECTION + GB:GENE uvsW.1 GB:PRODUCT hypothetical protein GB:NOTE similar to C-term of T4 accession NP_049796.1; UvsW.1 GB:PROTEIN_ID AAQ81493.1 GB:DB_XREF GI:34732956 GB:GENE:GENE uvsW.1 LENGTH 76 SQ:AASEQ MLSFKSYLHEAMIDSFMGKIASCQTLEGLEELEKYYDKRVKEVDLKSSDDISIRDALAGKRTEFEGGDEEEQEEEF GT:EXON 1|1-76:0| BL:SWS:NREP 1 BL:SWS:REP 1->61|UVSW_BPT4|1e-23|77.0|61/587| SEG 63->75|efeggdeeeqeee| BL:PDB:NREP 1 BL:PDB:REP 1->61|2jpnA|4e-24|77.0|61/79| RP:PFM:NREP 1 RP:PFM:REP 20->61|PF11637|4e-12|90.5|42/54|UvsW| HM:PFM:NREP 1 HM:PFM:REP 20->73|PF11637|2.3e-32|72.2|54/54|UvsW| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 80.3 SQ:SECSTR cccccHHHHHHTTccHHHHHHTcccHHHHHHHHHHHHHHTTTcccTTHHHHHHHHHHHHHH############### DISOP:02AL 1-2,63-77| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHcc //