[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : uvsY.-2
DDBJ      :uvsY.-2      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->38 PF10886 * DUF2685 5e-06 60.0 %
:HMM:PFM   8->58 PF10886 * DUF2685 8.1e-29 68.6 51/54  
:BLT:SWISS 9->38 Y11A_BPT4 1e-06 46.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81494.1 GT:GENE uvsY.-2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(115033..115209) GB:FROM 115033 GB:TO 115209 GB:DIRECTION - GB:GENE uvsY.-2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049797.1; UvsY.-2 GB:PROTEIN_ID AAQ81494.1 GB:DB_XREF GI:34732957 GB:GENE:GENE uvsY.-2 LENGTH 58 SQ:AASEQ MQLPQGTTLCPACKMPVEKVLAVDTPYGPAHPGPCAHHLEALPLSESESILEETQLLM GT:EXON 1|1-58:0| BL:SWS:NREP 1 BL:SWS:REP 9->38|Y11A_BPT4|1e-06|46.7|30/55| SEG 39->57|lealplsesesileetqll| RP:PFM:NREP 1 RP:PFM:REP 9->38|PF10886|5e-06|60.0|30/54|DUF2685| HM:PFM:NREP 1 HM:PFM:REP 8->58|PF10886|8.1e-29|68.6|51/54|DUF2685| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccccccccccccccHHHHHHccccccccccccHHHHHHHccccHHHHHHHHHHHcc //