[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : vs.1
DDBJ      :vs.1         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.2.1
:183 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   65->167 1dkkA PDBj 7e-08 13.1 %
:RPS:SCOP  65->158 1qsaA2  d.2.1.6 * 7e-07 23.6 %
:HMM:SCOP  65->180 153lA_ d.2.1.5 * 1.9e-07 29.9 %
:RPS:PFM   59->176 PF10715 * REGB_T4 7e-23 47.5 %
:HMM:PFM   29->182 PF10715 * REGB_T4 5.2e-57 42.1 145/150  
:BLT:SWISS 6->181 Y06E_BPT4 2e-32 41.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81426.1 GT:GENE vs.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(59336..59887) GB:FROM 59336 GB:TO 59887 GB:DIRECTION - GB:GENE vs.1 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049725.1; T4 gene synonym: vs.2; Vs.1 GB:PROTEIN_ID AAQ81426.1 GB:DB_XREF GI:34732888 GB:GENE:GENE vs.1 LENGTH 183 SQ:AASEQ MRFLTILILLFTSHVFAGPSAPDFTDTQKTNLSYAYYYGKGYDLMGNQRDVDHPNFLNQRHLGTLFAAIAWEESSAGLNTGRSKKGHHAYGMFQNLYKTVVKKMDQRGIPFRHWYLKKDLETRSGSAEWAMDELHYWLTVRKGNIRLALASYNAGWNYKAGLGYADRVLSKNQRLKSMEFIYK GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 6->181|Y06E_BPT4|2e-32|41.9|172/181| RP:PDB:NREP 1 RP:PDB:REP 65->167|1dkkA|7e-08|13.1|99/129| RP:PFM:NREP 1 RP:PFM:REP 59->176|PF10715|7e-23|47.5|118/159|REGB_T4| HM:PFM:NREP 1 HM:PFM:REP 29->182|PF10715|5.2e-57|42.1|145/150|REGB_T4| RP:SCP:NREP 1 RP:SCP:REP 65->158|1qsaA2|7e-07|23.6|89/168|d.2.1.6| HM:SCP:REP 65->180|153lA_|1.9e-07|29.9|107/0|d.2.1.5|1/1|Lysozyme-like| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1----------------------------------------------------------------------------------------------------------------------------2---------- STR:NPRED 110 STR:RPRED 60.1 SQ:SECSTR ################################################################HHHHHHHHHHTTcTTcEEcTTccEEETTTTEETTTTcccccccTTcccTTcTTcccGGGGGccccHHHHHHHHHHHTcccGGGGcHHHHHHTTTccGGGGGTTcGGGGGT######### PSIPRED cHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHcccccccccccccHHHHHHHHHHHHHHcccHHcccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHccc //