[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Burkholderia cepacia phage Bcep781 (bpbc0)
Gene : ORF38
DDBJ      :ORF38        hypothetical protein ORF38
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_705667.1 GT:GENE ORF38 GT:PRODUCT hypothetical protein ORF38 GT:DATABASE NC_004333 GT:ORG bpbc0 GB:ACCESSION NC_004333 GB:LOCATION complement(29299..29505) GB:FROM 29299 GB:TO 29505 GB:DIRECTION - GB:GENE ORF38 GB:PRODUCT hypothetical protein ORF38 GB:PROTEIN_ID NP_705667.1 GB:DB_XREF GI:23752352 GB:GENE:GENE ORF38 LENGTH 68 SQ:AASEQ MTHFRTVEVAMKGSQRRDGERRYAVCFAGDEPLEVRVRQRMGWYTLWLQGEPFKNRIAMDAIKAARAA GT:EXON 1|1-68:0| SEG 56->67|riamdaikaara| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-2,12-17,67-69| PSIPRED cccEEEEEEEEcccccccccEEEEEEEEccccEEEEEEccccEEEEEEEccccccHHHHHHHHHHccc //