[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Burkholderia cepacia phage Bcep781 (bpbc0)
Gene : ORF44
DDBJ      :ORF44        hypothetical protein ORF44
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_705673.1 GT:GENE ORF44 GT:PRODUCT hypothetical protein ORF44 GT:DATABASE NC_004333 GT:ORG bpbc0 GB:ACCESSION NC_004333 GB:LOCATION complement(35684..36073) GB:FROM 35684 GB:TO 36073 GB:DIRECTION - GB:GENE ORF44 GB:PRODUCT hypothetical protein ORF44 GB:PROTEIN_ID NP_705673.1 GB:DB_XREF GI:23752358 GB:GENE:GENE ORF44 LENGTH 129 SQ:AASEQ MSLIVIPIKATANQVASTVLDGLNAQIALMTTDFGLFADVAYNGVRVATGRLCLDRTDINAAKYLGLPQPLFFADLQGTSDPAWTGFGTRYLLCYGTPPDAVIVPEPTLAFATEGRLDIDFVLDKSILG GT:EXON 1|1-129:0| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-1| PSIPRED ccEEEEEEEcccccEEEEEEcccEEEEEEEEcccEEEEEEEEccEEEEEEEEEEEccccHHHHHccccccEEEEEccccccHHHHccccEEEEEEEcccccEEcccccEEEEccccEEEEEEEEccccc //