[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Burkholderia cepacia phage Bcep781 (bpbc0)
Gene : ORF5
DDBJ      :ORF5         hypothetical protein ORF5
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->64 PF04883 * DUF646 3.6e-05 29.6 27/106  
:BLT:SWISS 20->103 CARB_LACAC 4e-04 34.5 %

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_705633.1 GT:GENE ORF5 GT:PRODUCT hypothetical protein ORF5 GT:DATABASE NC_004333 GT:ORG bpbc0 GB:ACCESSION NC_004333 GB:LOCATION complement(4358..4774) GB:FROM 4358 GB:TO 4774 GB:DIRECTION - GB:GENE ORF5 GB:PRODUCT hypothetical protein ORF5 GB:PROTEIN_ID NP_705633.1 GB:DB_XREF GI:23752318 GB:GENE:GENE ORF5 LENGTH 138 SQ:AASEQ MSVKAGVLAGATYPDESGKKLADGSILKKDPRAGLPVAMIAMALNYGTSKLPARPFMEKTIADRSAEWIKGLTVMMTMGYDAEVAMGQIGQAMKDDIKTTISEWPADNNADWAGKKGFNHGLIWTSHLLNSIEQEIVK GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 20->103|CARB_LACAC|4e-04|34.5|84/1062| HM:PFM:NREP 1 HM:PFM:REP 36->64|PF04883|3.6e-05|29.6|27/106|DUF646| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-2,112-116| PSIPRED ccEEEEEEcccccccccccHHHcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccHHHHccEEEEEEEc //