[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Burkholderia cepacia phage Bcep781 (bpbc0)
Gene : ORF58
DDBJ      :ORF58        hypothetical protein ORF58
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_705687.1 GT:GENE ORF58 GT:PRODUCT hypothetical protein ORF58 GT:DATABASE NC_004333 GT:ORG bpbc0 GB:ACCESSION NC_004333 GB:LOCATION 46720..47031 GB:FROM 46720 GB:TO 47031 GB:DIRECTION + GB:GENE ORF58 GB:PRODUCT hypothetical protein ORF58 GB:PROTEIN_ID NP_705687.1 GB:DB_XREF GI:23752372 GB:GENE:GENE ORF58 LENGTH 103 SQ:AASEQ MPQPTNTELAARYKKLPVDQFTITELTDALGVEVSAALLGTSKRAVYTVRNTNVLGIERHKLLIDAVRSKETECRERLLFMLQRRERREASRAAKAARADDKQ GT:EXON 1|1-103:0| SEG 84->102|rrerreasraakaaraddk| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-5,85-104| PSIPRED cccccccHHHHHHHHcccHHEEHHHHHHHHcHHHHHHHHcccccEEEEEEcccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //