[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Shigella flexneri bacteriophage V (bpsf1)
Gene : orf1
DDBJ      :orf1         small terminase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  1/199 : Viruses  5/175   --->[See Alignment]
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   71->148 3ckyA PDBj 6e-04 24.4 %
:RPS:PFM   60->153 PF05119 * Terminase_4 1e-11 36.2 %
:HMM:PFM   57->153 PF05119 * Terminase_4 2.5e-27 33.0 97/100  
:BLT:SWISS 14->65 Y1459_RHOSR 8e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_599033.1 GT:GENE orf1 GT:PRODUCT small terminase subunit GT:DATABASE NC_003444 GT:ORG bpsf1 GB:ACCESSION NC_003444 GB:LOCATION 68..562 GB:FROM 68 GB:TO 562 GB:DIRECTION + GB:GENE orf1 GB:PRODUCT small terminase subunit GB:PROTEIN_ID NP_599033.1 GB:DB_XREF GI:19548991 GB:GENE:GENE orf1 LENGTH 164 SQ:AASEQ MAGTAGRSGRRPKPTARKALAGNPGKRALNKDEPVFTPIKGVEPPEWFAEEDLPLATIMWQLTTKELCGQGLLCVTDLAVLERWCVAYEFWRRAVKNIARQGNTITGAMGGMVKNPELTAKKEQESEMSSTGAMLGLDPSSRQRLIGLAGKKKATNPFLKIIES GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 14->65|Y1459_RHOSR|8e-04|30.8|52/224| RP:PDB:NREP 1 RP:PDB:REP 71->148|3ckyA|6e-04|24.4|78/297| RP:PFM:NREP 1 RP:PFM:REP 60->153|PF05119|1e-11|36.2|94/99|Terminase_4| HM:PFM:NREP 1 HM:PFM:REP 57->153|PF05119|2.5e-27|33.0|97/100|Terminase_4| OP:NHOMO 39 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------1--------------------------------------------------------------------------------------------1----------------------------------------------------------1--------1---------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------1---1--11--1-1-------1-1-1--11-----1-------11---121-------------1111-----------------------------1--1--1--------------------------------1-------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ---------------------------------------------------11----------------------------------------------------------------------------------------------1--1-1---------------------- STR:NPRED 78 STR:RPRED 47.6 SQ:SECSTR ######################################################################TcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHT################ DISOP:02AL 1-9,26-38,142-158| PSIPRED ccccccccccccccHHHHHHHcccccccccHHHccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHc //