[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Shigella flexneri bacteriophage V (bpsf1)
Gene : orf30
DDBJ      :orf30        unknown
Swiss-Prot:YFDR_ECOLI   RecName: Full=Uncharacterized protein yfdR;

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
a.211.1
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->175 2gz4D PDBj 4e-13 33.6 %
:RPS:SCOP  43->149 1xx7A  a.211.1.1 * 9e-07 25.2 %
:HMM:SCOP  20->97 2paqA1 a.211.1.1 * 0.00012 29.3 %
:HMM:PFM   47->105 PF03387 * Herpes_UL46 0.00038 23.7 59/444  
:HMM:PFM   10->51 PF09475 * Dot_icm_IcmQ 0.0006 31.7 41/179  
:BLT:SWISS 1->178 YFDR_ECOLI 3e-93 97.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_599062.1 GT:GENE orf30 GT:PRODUCT unknown GT:DATABASE NC_003444 GT:ORG bpsf1 GB:ACCESSION NC_003444 GB:LOCATION complement(22700..23236) GB:FROM 22700 GB:TO 23236 GB:DIRECTION - GB:GENE orf30 GB:PRODUCT unknown GB:PROTEIN_ID NP_599062.1 GB:DB_XREF GI:19549017 GB:GENE:GENE orf30 LENGTH 178 SQ:AASEQ MSFIKTFSGKHFYYDRINKDDIDINDIAVSLSNICRFAGHLSHFYSVAQHAVLCSQLVPQEFAFEALMHDATEAYCQDIPAPLKRLLPDYKQMEEKIDAVIREKYGLPPVMSTPVKYADLIMLATERRDLGLDDGSFWPVLEGIPATEMFNVIPLAPGHAYGIFMERFNELSELRKCA GT:EXON 1|1-178:0| SW:ID YFDR_ECOLI SW:DE RecName: Full=Uncharacterized protein yfdR; SW:GN Name=yfdR; OrderedLocusNames=b2361, JW2358; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->178|YFDR_ECOLI|3e-93|97.2|178/178| SEG 17->27|inkddidindi| BL:PDB:NREP 1 BL:PDB:REP 28->175|2gz4D|4e-13|33.6|146/197| HM:PFM:NREP 2 HM:PFM:REP 47->105|PF03387|0.00038|23.7|59/444|Herpes_UL46| HM:PFM:REP 10->51|PF09475|0.0006|31.7|41/179|Dot_icm_IcmQ| RP:SCP:NREP 1 RP:SCP:REP 43->149|1xx7A|9e-07|25.2|107/172|a.211.1.1| HM:SCP:REP 20->97|2paqA1|0.00012|29.3|75/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 41 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-------------------------------------------111----------1--------------------------11---------------------------------------------------------------------------1----------------------------1-1------------------------------------------------------------------------------------------------------------1--112-2---1-1---1-1-131--1--2--1---------111------------------------------------------------------------------------------------1------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 82.6 SQ:SECSTR ###########################HHHHTTcccGGGcccccccHHHHHHHcTTccHHHHHHEHHTTTTTHHHHccccHHHHTTccTHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHTcHHHHHHHcccccc#cGGGcccccccHHHHHHHHHHHHHHHHHHH### DISOP:02AL 177-179| PSIPRED ccEEccccccccHHccccHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHccc //