[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : cI
DDBJ      :cI           repressor protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  8/175   --->[See Alignment]
a.35.1
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->62 1b0nA PDBj 2e-05 31.6 %
:RPS:PDB   1->65 2croA PDBj 5e-10 18.5 %
:RPS:SCOP  6->65 1perL  a.35.1.2 * 1e-09 30.0 %
:HMM:SCOP  1->69 2b5aA1 a.35.1.3 * 1.2e-08 29.0 %
:HMM:PFM   8->61 PF01381 * HTH_3 1.3e-13 33.3 54/55  
:HMM:PFM   96->113 PF06543 * Lac_bphage_repr 0.00039 44.4 18/49  
:BLT:SWISS 6->115 YOBD_BACSU 4e-06 28.3 %

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150136.1 GT:GENE cI GT:PRODUCT repressor protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION complement(2115..2477) GB:FROM 2115 GB:TO 2477 GB:DIRECTION - GB:GENE cI GB:PRODUCT repressor protein GB:FUNCTION regulation of transcription GB:PROTEIN_ID NP_150136.1 GB:DB_XREF GI:15088747 GOA:Q94M75 SPTREMBL:Q94M75 GB:GENE:GENE cI LENGTH 120 SQ:AASEQ MFETFEKIKSLAKKQGISLNTLEDRVGLGKNYIYSLKNKKTPSAEHISKIADYFNVSTDYLLGRTDNPTIANKKEQFFFEGKEVDVEELASTAMRFNGKPLTEEDKKAIQNIIEIYLRKQ GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 6->115|YOBD_BACSU|4e-06|28.3|99/112| BL:PDB:NREP 1 BL:PDB:REP 6->62|1b0nA|2e-05|31.6|57/103| RP:PDB:NREP 1 RP:PDB:REP 1->65|2croA|5e-10|18.5|65/65| HM:PFM:NREP 2 HM:PFM:REP 8->61|PF01381|1.3e-13|33.3|54/55|HTH_3| HM:PFM:REP 96->113|PF06543|0.00039|44.4|18/49|Lac_bphage_repr| RP:SCP:NREP 1 RP:SCP:REP 6->65|1perL|1e-09|30.0|60/63|a.35.1.2| HM:SCP:REP 1->69|2b5aA1|1.2e-08|29.0|69/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 78 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---11----1-1------12-1-----1---21--------------------1-2---12---1-211-1--221--2311--1-2---------112-11-1331211-1121-------------------------1--------------------1-------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -1-----------------------------------------------------------------------------------1-1----------1--------1--1--------------1-1----------------------------------------------- STR:NPRED 119 STR:RPRED 99.2 SQ:SECSTR cccHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHTTcccccTTHHHHHHHTTccHHHHHHcccHccccHHHHHHHHHHTTccccccccccHHHHHccccHHHHHHHHHHHHHHHHc# DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHcccHHHHHccccccccccHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc //