[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf16
DDBJ      :orf16        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:144 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->64 PF11043 * DUF2856 0.00031 33.3 48/97  
:HMM:PFM   95->132 PF11503 * DUF3215 0.00073 21.1 38/77  
:BLT:SWISS 18->92 CH601_SYNAS 3e-05 32.0 %

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150148.1 GT:GENE orf16 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 8929..9363 GB:FROM 8929 GB:TO 9363 GB:DIRECTION + GB:GENE orf16 GB:PRODUCT hypothetical protein GB:NOTE ORF16 GB:PROTEIN_ID NP_150148.1 GB:DB_XREF GI:15088759 SPTREMBL:Q94M63 GB:GENE:GENE orf16 LENGTH 144 SQ:AASEQ MDKKLIGLDLTHIADGGLQEKLDKELEKVFDNILDLNTDAKAKRKVTITLTMSANEERTVVDTTMEVKSKFAPQNGVATTILIGRDFDTGQVHANELKSTVPGQMYFDENGEILTDIGQPVAEIEQQAETKSDIIDFNKKKVGN GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 18->92|CH601_SYNAS|3e-05|32.0|75/544| HM:PFM:NREP 2 HM:PFM:REP 16->64|PF11043|0.00031|33.3|48/97|DUF2856| HM:PFM:REP 95->132|PF11503|0.00073|21.1|38/77|DUF3215| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------1-------------------------11------------1----------------------1-1---1--------1----------------------1--------------1-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------- DISOP:02AL 1-3,143-145| PSIPRED ccccEEEEEHHHHHccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEccccEEEEEEEEEEEcccccccccEEEEEcccccccHHHHHHHHHHccccEEEcccHHHHHHHccHHHHHHccccccHHHHcccHHHccc //