[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf23
DDBJ      :orf23        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   54->83 PF00833 * Ribosomal_S17e 0.00066 43.3 30/122  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150154.1 GT:GENE orf23 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 11816..12103 GB:FROM 11816 GB:TO 12103 GB:DIRECTION + GB:GENE orf23 GB:PRODUCT hypothetical protein GB:NOTE ORF23 GB:PROTEIN_ID NP_150154.1 GB:DB_XREF GI:15088765 SPTREMBL:Q94M57 GB:GENE:GENE orf23 LENGTH 95 SQ:AASEQ MTQTLEEGMKNQSKCIKIPMEIRPFDVGYRIVNKHGQALALKNGASIFALPSLAEKAIKKEFGKNDPDFDIEKHFVEEVAIVNLSKFHSYFEEVE GT:EXON 1|1-95:0| HM:PFM:NREP 1 HM:PFM:REP 54->83|PF00833|0.00066|43.3|30/122|Ribosomal_S17e| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------- DISOP:02AL 1-9,95-96| PSIPRED ccHHHHHHHccHHHEEEcccEEccHHHHHHHHHccccEEEEccccEEEEEHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcc //