[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf24
DDBJ      :orf24        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->55 PF11213 * DUF3006 0.00025 26.5 49/71  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150155.1 GT:GENE orf24 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 12103..12276 GB:FROM 12103 GB:TO 12276 GB:DIRECTION + GB:GENE orf24 GB:PRODUCT hypothetical protein GB:NOTE ORF24 GB:PROTEIN_ID NP_150155.1 GB:DB_XREF GI:15088766 SPTREMBL:Q94M56 GB:GENE:GENE orf24 LENGTH 57 SQ:AASEQ MEDEQNILETQLILGKQVLEIVLDLLKDDSKIGVVLPLNINDREFTITVEKEVTDRD GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 2->55|PF11213|0.00025|26.5|49/71|DUF3006| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------- DISOP:02AL 1-5,53-58| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEEEEEccccc //