[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf25
DDBJ      :orf25        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
b.172.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->136 2p84A PDBj 1e-12 47.9 %
:RPS:SCOP  60->136 2i2lA1  b.172.1.1 * 4e-05 27.9 %
:RPS:PFM   5->135 PF09643 * YopX 3e-13 43.8 %
:HMM:PFM   4->136 PF09643 * YopX 2.5e-32 37.6 117/122  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150156.1 GT:GENE orf25 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 12291..12710 GB:FROM 12291 GB:TO 12710 GB:DIRECTION + GB:GENE orf25 GB:PRODUCT hypothetical protein GB:NOTE ORF25 GB:PROTEIN_ID NP_150156.1 GB:DB_XREF GI:15088767 SPTREMBL:Q94M55 GB:GENE:GENE orf25 LENGTH 139 SQ:AASEQ MIPKFRVWHHELGRLMSVKCMFFQDSEIEEFELNDTLRNDYITAYPDEIELMQSTGLKDKNGKEIFEGDIVRTTRFLGRADEIGGFYEYEKDYVGVVKVLEGSWVIDTGSVAVRLWSEIDESEVLGNIYENLEFLEVNE GT:EXON 1|1-139:0| BL:PDB:NREP 1 BL:PDB:REP 1->136|2p84A|1e-12|47.9|117/133| RP:PFM:NREP 1 RP:PFM:REP 5->135|PF09643|3e-13|43.8|121/126|YopX| HM:PFM:NREP 1 HM:PFM:REP 4->136|PF09643|2.5e-32|37.6|117/122|YopX| RP:SCP:NREP 1 RP:SCP:REP 60->136|2i2lA1|4e-05|27.9|68/130|b.172.1.1| OP:NHOMO 24 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------1----------------3----------------------1---------1---------------11-11-322---11--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------- STR:NPRED 132 STR:RPRED 95.0 SQ:SECSTR ccccEEEEcHHHHHccccccEEEcccEEEEETTEEEEEccccccGGGGccEEEEEEEEcTTccEEETTEEEEET####ETTTTccEEEEEEGGGTEEEEETTEEEEEccccEEEcccGGGGEEEEEETTTcGGGGc### DISOP:02AL 137-140| PSIPRED cccccEEEEcccEEEEcccccccccccEEEEEcccccccEEEEEcHHcEEEEEEccccccccEEEEcccEEEEEEccccccccEEEEEEEcccEEEEEEEccEEEEEEccccccccEEEccEEEEEEEcccHHHHHccc //