[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf34
DDBJ      :orf34        hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:383 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->187 1ng6A PDBj 3e-04 30.6 %
:RPS:PDB   173->329 3dorA PDBj 3e-05 8.3 %
:RPS:PFM   22->367 PF06152 * Phage_min_cap2 3e-66 42.6 %
:HMM:PFM   10->368 PF06152 * Phage_min_cap2 8.1e-141 46.7 353/361  
:BLT:SWISS 24->383 VSP1_BPLLH 3e-43 31.9 %

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150164.1 GT:GENE orf34 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 19031..20182 GB:FROM 19031 GB:TO 20182 GB:DIRECTION + GB:GENE orf34 GB:PRODUCT hypothetical protein GB:NOTE ORF34 GB:PROTEIN_ID NP_150164.1 GB:DB_XREF GI:15088775 SPTREMBL:Q94M47 GB:GENE:GENE orf34 LENGTH 383 SQ:AASEQ MKKKRKQITFNDQQFPLQMQGVGDIYEKLQIDIFDRMIKRLKERGSIDLMRNPYIWQLEKLNDMHMLNEQNLKLISERTGIAERLLRDVIENEGLKVYKDTKQQLEEDLNKIPEGEISNGVTDSLEAYSRQAVSDLNLINTTLPKSLQVAYKSIVEETVAQVVAGTKTSDVALHDTIMKWQKNAFTGFVDKGGRHWKADSYARAIIKSTTYKVYNEMRTRPAEELGVDTFYYSMKAMARPACSPLQGQIVTKGTGREIDGITIYSLLDYGYGTAAGCLGIHCGHYLTPFIVGVHELPNLPDYLKNLTPEQAEENARIEAGQRGLERLIKTHKERLHYAHTLQDDKMIQAERLKVRGYQTKIRNLINQHDFLTRDYRREKLYIS GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 24->383|VSP1_BPLLH|3e-43|31.9|354/371| BL:PDB:NREP 1 BL:PDB:REP 58->187|1ng6A|3e-04|30.6|121/148| RP:PDB:NREP 1 RP:PDB:REP 173->329|3dorA|3e-05|8.3|145/522| RP:PFM:NREP 1 RP:PFM:REP 22->367|PF06152|3e-66|42.6|338/354|Phage_min_cap2| HM:PFM:NREP 1 HM:PFM:REP 10->368|PF06152|8.1e-141|46.7|353/361|Phage_min_cap2| GO:PFM:NREP 2 GO:PFM GO:0005198|"GO:structural molecule activity"|PF06152|IPR009319| GO:PFM GO:0019028|"GO:viral capsid"|PF06152|IPR009319| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11------------------------------1-----------------------1---------1-1---11111-11-1----------------------------------1--------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -1----------------------------------------------------------------------------1----------------------------1-------------------1----------------------------------------------- STR:NPRED 254 STR:RPRED 66.3 SQ:SECSTR #########################################################HHHHHHHHHHTTcHHHHH######HHHHHHHHHHHHHHHTTcccccH#HHHHHHHHH#HHHHH#HHHHHHHHHHHHHHHHHHGGGcccccHHHHHHHHHHHHHHTTcccGGGHHHHHHHHHHHHHHTTcccccccccGGGccEEcccccccccccEE##EEEcTTccTHHHHHHHHHHHTTc###EEEEEc#ccccccc###cEEEEccccccccccEEEEEEEcEEEEcTTccccTTTcccccEEccccHHHHHTTccHHHHHHHHHHHHH###################################################### DISOP:02AL 1-6,8-10,378-378,383-384| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccEEEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccEEEEccccccccccccHHHHccccccccccccccccccEEcccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHEEcc //