[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf39
DDBJ      :orf39        putative minor capsid protein 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->123 PF10665 * Phage_Gp9 8e-14 52.8 %
:HMM:PFM   12->122 PF10665 * Phage_Gp9 1.4e-09 23.3 103/114  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150169.1 GT:GENE orf39 GT:PRODUCT putative minor capsid protein 2 GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 22451..22822 GB:FROM 22451 GB:TO 22822 GB:DIRECTION + GB:GENE orf39 GB:PRODUCT putative minor capsid protein 2 GB:FUNCTION structural protein GB:NOTE ORF39 GB:PROTEIN_ID NP_150169.1 GB:DB_XREF GI:15088780 SPTREMBL:Q94M42 GB:GENE:GENE orf39 LENGTH 123 SQ:AASEQ MIDKRLLKGIDKRLLKDVLTIKKVADKNDYGDEVYSEPLTIKNVRFDRSVGGSGNRNSKTGTGNSKSRQKQGVIYLYPSLSFVTVDNSWMGAKVNDGIGDYTINGFQTNYYDGEIFSQEIEVI GT:EXON 1|1-123:0| RP:PFM:NREP 1 RP:PFM:REP 10->123|PF10665|8e-14|52.8|106/107|Phage_Gp9| HM:PFM:NREP 1 HM:PFM:REP 12->122|PF10665|1.4e-09|23.3|103/114|Phage_Gp9| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-1---11111-11-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-------------------1----------------------------------------------- DISOP:02AL 1-1,52-69| PSIPRED ccHHHHHHHHHHHHHHHHEEEEEEEccccccccEEcccEEEccEEEEccccccccccccccccccccccccEEEEEccccEEEEEEccEEccEEEcccccEEEEEEEEEEEccEEEEEEEEEc //