[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf4
DDBJ      :orf4         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->45 PF06153 * DUF970 2.9e-05 32.4 37/109  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150137.1 GT:GENE orf4 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 2774..2965 GB:FROM 2774 GB:TO 2965 GB:DIRECTION + GB:GENE orf4 GB:PRODUCT hypothetical protein GB:NOTE ORF4 GB:PROTEIN_ID NP_150137.1 GB:DB_XREF GI:15088748 SPTREMBL:Q94M74 GB:GENE:GENE orf4 LENGTH 63 SQ:AASEQ MPDITNGREKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILSGTTKGPRANSFILQVIEDYGIE GT:EXON 1|1-63:0| HM:PFM:NREP 1 HM:PFM:REP 9->45|PF06153|2.9e-05|32.4|37/109|DUF970| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----------2-1---11-111---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------1----------------1----------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHccc //