[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf5
DDBJ      :orf5         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.4.5
:88 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->55 2acjC PDBj 3e-05 15.4 %
:RPS:SCOP  1->56 1qbjA  a.4.5.19 * 4e-05 15.1 %
:HMM:SCOP  1->85 2p4wA1 a.4.5.64 * 0.00011 30.3 %
:HMM:PFM   1->45 PF02082 * Rrf2 5.2e-07 26.7 45/83  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150138.1 GT:GENE orf5 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 3140..3406 GB:FROM 3140 GB:TO 3406 GB:DIRECTION + GB:GENE orf5 GB:PRODUCT hypothetical protein GB:NOTE ORF5 GB:PROTEIN_ID NP_150138.1 GB:DB_XREF GI:15088749 SPTREMBL:Q94M73 GB:GENE:GENE orf5 LENGTH 88 SQ:AASEQ MMVVLANHPNWQVYPDEIAKRKGVGRDMIDRHLKKLEDAGYMRVIKKSLGRGRGVQTFRFFSDTKITDFQFEIMLQRLDEAIEKLSTV GT:EXON 1|1-88:0| RP:PDB:NREP 1 RP:PDB:REP 1->55|2acjC|3e-05|15.4|52/66| HM:PFM:NREP 1 HM:PFM:REP 1->45|PF02082|5.2e-07|26.7|45/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 1->56|1qbjA|4e-05|15.1|53/65|a.4.5.19| HM:SCP:REP 1->85|2p4wA1|0.00011|30.3|76/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------1-1-1---12-1111-12--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------- STR:NPRED 74 STR:RPRED 84.1 SQ:SECSTR HHHHHHTcTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEEEcccccEEEEcccEEEEEEEETTccEE############## DISOP:02AL 22-28| PSIPRED cEEEEcccccccccHHHHHHHcccHHHHHHHHHHHHHHcccEEEHEHHccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHcc //