[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf51
DDBJ      :orf51        putative holin 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->107 PF09682 * Holin_LLH 2e-18 61.3 %
:HMM:PFM   1->107 PF09682 * Holin_LLH 1.1e-43 58.5 106/108  
:BLT:SWISS 8->89 RUVC_ORITB 5e-05 29.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150181.1 GT:GENE orf51 GT:PRODUCT putative holin 2 GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 38752..39084 GB:FROM 38752 GB:TO 39084 GB:DIRECTION + GB:GENE orf51 GB:PRODUCT putative holin 2 GB:FUNCTION lysis protein GB:NOTE ORF51 GB:PROTEIN_ID NP_150181.1 GB:DB_XREF GI:15088792 SPTREMBL:Q94M30 GB:GENE:GENE orf51 LENGTH 110 SQ:AASEQ MQQITEIIIAFATSFLTVAVGGIVKAVKDYLLRKGGEKAVIIAEILAKNAVHAVEQVASETGYKGEEKLEQARAKVRAELTKYNISMTDKDLDTFVESAVKQMNDAWKGR GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 8->89|RUVC_ORITB|5e-05|29.3|82/159| TM:NTM 1 TM:REGION 7->29| RP:PFM:NREP 1 RP:PFM:REP 1->107|PF09682|2e-18|61.3|106/107|Holin_LLH| HM:PFM:NREP 1 HM:PFM:REP 1->107|PF09682|1.1e-43|58.5|106/108|Holin_LLH| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-----------211-11--11-1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------1-1----------------------------------------------- DISOP:02AL 1-2,105-111| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHHHHHHHHHHHccc //