[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae bacteriophage MM1 (bpsp3)
Gene : orf6
DDBJ      :orf6         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->72 PF02529 * PetG 0.00097 64.3 14/37  

SeqInfo AminoSeq See neighboring genes
Links Genpept Abbreviations Back to title page
GT:ID NP_150139.1 GT:GENE orf6 GT:PRODUCT hypothetical protein GT:DATABASE NC_003050 GT:ORG bpsp3 GB:ACCESSION NC_003050 GB:LOCATION 3638..3904 GB:FROM 3638 GB:TO 3904 GB:DIRECTION + GB:GENE orf6 GB:PRODUCT hypothetical protein GB:NOTE ORF6 GB:PROTEIN_ID NP_150139.1 GB:DB_XREF GI:15088750 SPTREMBL:Q94M72 GB:GENE:GENE orf6 LENGTH 88 SQ:AASEQ METVQIVRIKDVIIEKISANDEELERIFGCSKRQAGDMRREMKKLPSQQKYLRNDGQLVTIKGFDAYLQYRGSQSWKKEMAKTVKMTR GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 59->72|PF02529|0.00097|64.3|14/37|PetG| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------1-1----------------------------------------------- DISOP:02AL 1-2,35-51,79-80,84-89| PSIPRED cccEEEEEEHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHcccEEEEEEcHHHHHHHcccHHHHHHHHHHHHHcc //