[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Vibriophage VP2 (bpvp2)
Gene : AAR97630.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
d.65.1
:157 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->128 1lbuA2  d.65.1.1 * 1e-07 12.3 %
:HMM:SCOP  6->142 1lbuA2 d.65.1.1 * 9.5e-11 23.4 %
:HMM:PFM   6->123 PF08291 * Peptidase_M15_3 2.2e-10 27.4 106/110  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAR97630.1 GT:GENE AAR97630.1 GT:PRODUCT hypothetical protein GT:DATABASE AY505112 GT:ORG bpvp2 GB:ACCESSION AY505112 GB:LOCATION 8537..9010 GB:FROM 8537 GB:TO 9010 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE similar to bacteriophage KVP40.0291 hypothetical protein deposited under GenBank Accession Number AAQ64361 GB:PROTEIN_ID AAR97630.1 GB:DB_XREF GI:40950039 LENGTH 157 SQ:AASEQ MQKRGHFDIREFVSEADFKKYGLKAWRFVCPALLHTLNTLRDDLDCTITVNNWMYGGNFRWRGVRSSKSADYSETSMHSWGRAADFDVKGMTAPEVVVHIIKNRDKYPLITFIEIDINWVHIDVGQREYNPAEGLKLWSPKRKYVDIDTYLKEQGHG GT:EXON 1|1-157:0| HM:PFM:NREP 1 HM:PFM:REP 6->123|PF08291|2.2e-10|27.4|106/110|Peptidase_M15_3| RP:SCP:NREP 1 RP:SCP:REP 6->128|1lbuA2|1e-07|12.3|114/130|d.65.1.1| HM:SCP:REP 6->142|1lbuA2|9.5e-11|23.4|124/0|d.65.1.1|1/1|Hedgehog/DD-peptidase| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------1----------------------------------11----------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,155-158| PSIPRED ccccccccHHHHccHHHHHHccHHHHEEEcHHHHHHHHHHHHHccccEEEEccccccccccccccccHHccHHHHHHHHcccEEEEEcccccccEEEEEEEccHHHcccEEEEcccEEEEEEEccccccccccccEEcccccccccHHHHHHHHccc //