[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Vibriophage VP2 (bpvp2)
Gene : AAR97636.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->62 PF02403 * Seryl_tRNA_N 0.00092 22.2 45/108  
:BLT:SWISS 16->62 CC123_DANRE 8e-05 42.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAR97636.1 GT:GENE AAR97636.1 GT:PRODUCT hypothetical protein GT:DATABASE AY505112 GT:ORG bpvp2 GB:ACCESSION AY505112 GB:LOCATION complement(21846..22163) GB:FROM 21846 GB:TO 22163 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to Burkholderia cepacia phage Bcep781 ORF57 deposited under GenBank Accession Number AAN38061 GB:PROTEIN_ID AAR97636.1 GB:DB_XREF GI:40950045 LENGTH 105 SQ:AASEQ MPDMSEMNGGDFKETLEDKLTETLNERGSRYGDFQEISSISEQIQTLVFASDSLKEPKLRLNRAQRECIRQLSTKLARIACGDAQYPDNWHDIRGYGQLGEKHCK GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 16->62|CC123_DANRE|8e-05|42.6|47/695| HM:PFM:NREP 1 HM:PFM:REP 18->62|PF02403|0.00092|22.2|45/108|Seryl_tRNA_N| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----------111-----------------------------------------11----------------------------------------------------------------------------------------------------------1------------ DISOP:02AL 1-7,105-106| PSIPRED cccHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcc //