[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Vibriophage VP2 (bpvp2)
Gene : AAR97637.1
DDBJ      :             hydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
a.211.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->125 2pauB PDBj 2e-07 30.8 %
:RPS:PDB   11->104 2dqbC PDBj 1e-05 17.6 %
:RPS:SCOP  25->127 1xx7A  a.211.1.1 * 2e-13 24.2 %
:HMM:SCOP  19->114 1ynbA1 a.211.1.1 * 1.6e-14 25.0 %
:HMM:PFM   41->105 PF08668 * HDOD 1.6e-06 25.4 63/196  
:BLT:SWISS 35->99 YFBR_SALTY 9e-08 38.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAR97637.1 GT:GENE AAR97637.1 GT:PRODUCT hydrolase GT:DATABASE AY505112 GT:ORG bpvp2 GB:ACCESSION AY505112 GB:LOCATION complement(23019..23402) GB:FROM 23019 GB:TO 23402 GB:DIRECTION - GB:PRODUCT hydrolase GB:NOTE similar to Clostridium thermocellum ATCC27405 predicted hydrolases of HD superfamily GB:PROTEIN_ID AAR97637.1 GB:DB_XREF GI:40950046 LENGTH 127 SQ:AASEQ MSITSFWRECIKRLPNIAGENEMMQIQNILRAGHVPRWQLCDTTRTQSIAEHMFNVAMIARHMCAHIGITGDEMNEIVMQALTHDMDEVILGDMPTVTKQRLREAGIEPNGLIDCTETIIEDPLAKH GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 35->99|YFBR_SALTY|9e-08|38.5|65/199| BL:PDB:NREP 1 BL:PDB:REP 35->125|2pauB|2e-07|30.8|91/177| RP:PDB:NREP 1 RP:PDB:REP 11->104|2dqbC|1e-05|17.6|91/360| HM:PFM:NREP 1 HM:PFM:REP 41->105|PF08668|1.6e-06|25.4|63/196|HDOD| RP:SCP:NREP 1 RP:SCP:REP 25->127|1xx7A|2e-13|24.2|99/172|a.211.1.1| HM:SCP:REP 19->114|1ynbA1|1.6e-14|25.0|92/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 92.1 SQ:SECSTR ##########ccccccccccHHHHHHHHHHHcHHHHHGccccccccccHHHHHHHHHHHHHHHHHHHTccHHcccHHHHHHHHTTTTcccccHHHHHHHHHHGGTcccHHHHHHHHHHTcGGGHHHH DISOP:02AL 1-1,126-128| PSIPRED ccHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHcHHHcc //