[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Vibriophage VP2 (bpvp2)
Gene : AAR97640.1
DDBJ      :             single strand DNA-binding protein SSB
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   142->158 2jhrA PDBj 2e-04 82.4 %
:BLT:SWISS 145->158 SSB_VIBVU 1e-04 100.0 %
:REPEAT 2|7->44|67->103

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAR97640.1 GT:GENE AAR97640.1 GT:PRODUCT single strand DNA-binding protein SSB GT:DATABASE AY505112 GT:ORG bpvp2 GB:ACCESSION AY505112 GB:LOCATION complement(28861..29337) GB:FROM 28861 GB:TO 29337 GB:DIRECTION - GB:PRODUCT single strand DNA-binding protein SSB GB:NOTE similar to Vibrio cholerae single strand DNA-binding protein SSB deposited under GenBank Accession Number AAC72352 GB:PROTEIN_ID AAR97640.1 GB:DB_XREF GI:40950049 LENGTH 158 SQ:AASEQ MAQYDNTNRGTLGKNRQPKNDKSPHFTGKVDIRGTVYWLAGWRQEDFMSDDHYISLSLTGKDDASLTGSGRLENNRDKIGNRPDMVGRVIVEGAEYEISAWTKTHDNGKFLSIQVRAAGVRRPQDDKQFGTAYGDSHEDGTRPKYNEPPMDFDDDIPF GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 145->158|SSB_VIBVU|1e-04|100.0|14/179| NREPEAT 1 REPEAT 2|7->44|67->103| BL:PDB:NREP 1 BL:PDB:REP 142->158|2jhrA|2e-04|82.4|17/776| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24,120-145| PSIPRED cccccccccccccccccccccccccEEEEEEEEEEEEEEEccccccccccccEEEEEEEccccccccccccccccHHHcccccccEEEEEEEEEEEEEEEEEEccccccEEEEEEcHHHccccccccccccccccccccccccccccccccccccccc //