[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : aadK
DDBJ      :aadK         aminoglycoside 6-adenylyltransferase
Swiss-Prot:AADK_BACSU   RecName: Full=Aminoglycoside 6-adenylyltransferase;         EC=2.7.7.-;AltName: Full=AAD(6);

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.160.1d.218.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->282 2pbeA PDBj e-133 99.6 %
:RPS:SCOP  1->135 2pbeA2  d.218.1.13 * 3e-40 94.9 %
:RPS:SCOP  138->282 2pbeA1  a.160.1.5 * 2e-53 95.2 %
:RPS:PFM   1->279 PF04439 * Adenyl_transf 1e-86 54.3 %
:HMM:PFM   1->281 PF04439 * Adenyl_transf 1e-143 59.8 281/282  
:BLT:SWISS 1->284 AADK_BACSU e-172 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14620.1 GT:GENE aadK GT:PRODUCT aminoglycoside 6-adenylyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2735682..2736536) GB:FROM 2735682 GB:TO 2736536 GB:DIRECTION - GB:GENE aadK GB:PRODUCT aminoglycoside 6-adenylyltransferase GB:FUNCTION 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 8293959; Product type e : enzyme GB:PROTEIN_ID CAB14620.1 GB:DB_XREF GOA:P17585 InterPro:IPR007530 PDB:2PBE SubtiList:BG11037 UniProtKB/Swiss-Prot:P17585 GB:GENE:GENE aadK LENGTH 284 SQ:AASEQ MRSEQEMMDIFLDFALNDERIRLVTLEGSRTNRNIPPDNFQDYDISYFVTDVESFKENDQWLEIFGKRIMMQKPEDMELFPPELGNWFSYIILFEDGNKLDLTLIPIREAEDYFANNDGLVKVLLDKDSFINYKVTPNDRQYWIKRPTAREFDDCCNEFWMVSTYVVKGLARNEILFAIDHLNEIVRPNLLRMMAWHIASQKGYSFSMGKNYKFMKRYLSNKEWEELMSTYSVNGYQEMWKSLFTCYALFRKYSKAVSEGLAYKYPDYDEGITKYTEGIYCSVK GT:EXON 1|1-284:0| SW:ID AADK_BACSU SW:DE RecName: Full=Aminoglycoside 6-adenylyltransferase; EC=2.7.7.-;AltName: Full=AAD(6); SW:GN Name=aadK; OrderedLocusNames=BSU26790; SW:KW 3D-structure; Complete proteome; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->284|AADK_BACSU|e-172|100.0|284/284| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 1->282|2pbeA|e-133|99.6|251/251| RP:PFM:NREP 1 RP:PFM:REP 1->279|PF04439|1e-86|54.3|278/280|Adenyl_transf| HM:PFM:NREP 1 HM:PFM:REP 1->281|PF04439|1e-143|59.8|281/282|Adenyl_transf| RP:SCP:NREP 2 RP:SCP:REP 1->135|2pbeA2|3e-40|94.9|118/118|d.218.1.13| RP:SCP:REP 138->282|2pbeA1|2e-53|95.2|145/145|a.160.1.5| OP:NHOMO 60 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-1------------------------------------------------------------------------------------1111111111111122111-1111------1------1------------------1-11-------------------------1111---1--------------------------111---1-1--12--------------11----1--11-----11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------11-----------------------------------------------1111---------1---------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 248 STR:RPRED 87.3 SQ:SECSTR cccHHH##HHHHHHHHHcTTEEEEEEc############cccEEEEEEEccHHHHHTccGGGGGGccEE##EcTTc#cccccccTTcEEEEEEETTccEEEEEEEEGGGHHHHHHc#####cEEEEccccccccc##cGGGTEEccccHHHHHHHHHHHH#HHHHHHHHHHTTcHHHHHHHHHHTHHHHHHH##HHHHHHHHccEEE#cGGGTT#GGTccHHHHHHH#TTcccccHHH#HHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHH##### DISOP:02AL 284-285| PSIPRED cccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccEEEEEEcccHHHccccHHHHHHccEEEEEcccccccccccccccEEEEEEEccccEEEEEEccHHHHHHHHcccccEEEEEEccccccccccccccHHcccccccHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccc //