[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : abnA
DDBJ      :abnA         arabinan-endo 1,5-alpha-L-arabinase
Swiss-Prot:ABNA_BACSU   RecName: Full=Arabinan endo-1,5-alpha-L-arabinosidase;         EC=3.2.1.99;AltName: Full=Endo-1,5-alpha-L-arabinanase;         Short=ABN;AltName: Full=Endo-arabinanase;Flags: Precursor;

Homologs  Archaea  1/68 : Bacteria  101/915 : Eukaryota  54/199 : Viruses  0/175   --->[See Alignment]
b.67.2
:323 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   33->323 1uv4A PDBj e-179 100.0 %
:RPS:PDB   37->321 3d60A PDBj 2e-24 54.1 %
:RPS:SCOP  41->321 1gydB  b.67.2.1 * 5e-22 39.4 %
:HMM:SCOP  18->323 1wl7A1 b.67.2.1 * 2.2e-69 32.3 %
:RPS:PFM   44->269 PF04616 * Glyco_hydro_43 4e-27 42.0 %
:HMM:PFM   41->321 PF04616 * Glyco_hydro_43 3.7e-55 29.4 262/286  
:BLT:SWISS 1->323 ABNA_BACSU 0.0 100.0 %
:REPEAT 2|44->147|163->260

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14841.2 GT:GENE abnA GT:PRODUCT arabinan-endo 1,5-alpha-L-arabinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2949053..2950024) GB:FROM 2949053 GB:TO 2950024 GB:DIRECTION - GB:GENE abnA GB:PRODUCT arabinan-endo 1,5-alpha-L-arabinase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 14973026; Product type e: enzyme GB:PROTEIN_ID CAB14841.2 GB:DB_XREF GOA:P94522 InterPro:IPR006710 PDB:1UV4 SubtiList:BG11901 UniProtKB/Swiss-Prot:P94522 GB:GENE:GENE abnA LENGTH 323 SQ:AASEQ MKKKKTWKRFLHFSSAALAAGLIFTSAAPAEAAFWGASNELLHDPTMIKEGSSWYALGTGLTEERGLRVLKSSDAKNWTVQKSIFTTPLSWWSNYVPNYGQNQWAPDIQYYNGKYWLYYSVSSFGSNTSAIGLASSTSISSGGWKDEGLVIRSTSSNNYNAIDPELTFDKDGNPWLAFGSFWSGIKLTKLDKSTMKPTGSLYSIAARPNNGGALEAPTLTYQNGYYYLMVSFDKCCDGVNSTYKIAYGRSKSITGPYLDKSGKSMLEGGGTILDSGNDQWKGPGGQDIVNGNILVRHAYDANDNGIPKLLINDLNWSSGWPSY GT:EXON 1|1-323:0| SW:ID ABNA_BACSU SW:DE RecName: Full=Arabinan endo-1,5-alpha-L-arabinosidase; EC=3.2.1.99;AltName: Full=Endo-1,5-alpha-L-arabinanase; Short=ABN;AltName: Full=Endo-arabinanase;Flags: Precursor; SW:GN Name=abnA; OrderedLocusNames=BSU28810; SW:KW 3D-structure; Complete proteome; Direct protein sequencing;Glycosidase; Hydrolase; Secreted; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->323|ABNA_BACSU|0.0|100.0|323/323| GO:SWS:NREP 4 GO:SWS GO:0016798|"GO:hydrolase activity, acting on glycosyl bonds"|Glycosidase| GO:SWS GO:0008152|"GO:metabolic process"|Glycosidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| NREPEAT 1 REPEAT 2|44->147|163->260| BL:PDB:NREP 1 BL:PDB:REP 33->323|1uv4A|e-179|100.0|291/291| RP:PDB:NREP 1 RP:PDB:REP 37->321|3d60A|2e-24|54.1|281/314| RP:PFM:NREP 1 RP:PFM:REP 44->269|PF04616|4e-27|42.0|212/271|Glyco_hydro_43| HM:PFM:NREP 1 HM:PFM:REP 41->321|PF04616|3.7e-55|29.4|262/286|Glyco_hydro_43| GO:PFM:NREP 2 GO:PFM GO:0004553|"GO:hydrolase activity, hydrolyzing O-glycosyl compounds"|PF04616|IPR006710| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF04616|IPR006710| RP:SCP:NREP 1 RP:SCP:REP 41->321|1gydB|5e-22|39.4|277/315|b.67.2.1| HM:SCP:REP 18->323|1wl7A1|2.2e-69|32.3|300/0|b.67.2.1|1/1|Arabinanase/levansucrase/invertase| OP:NHOMO 352 OP:NHOMOORG 156 OP:PATTERN -----------------------------2-------------------------------------- --2-1---------------------------------11---1121-41---2----------3-1-2-1-222-32----------1196-1-------2-2-415-2-------------------------------------------------------------------------31---11---2---------------1244-2-----1-2---------3----------------------2-----------------11--11--------------------------------------------11-21----------3-------5-1---1----------------3------222-------------------------------------------1--111111111--1-------------------------------------------------------------2----------------------------------------------------------------------------------------------------14----------------------------------4---------2---2222----2------------------2-1-------------------------------1-112---------------------------------------------------------1---------------------------4-------------------------------------------11111111-------------------------------------------------------2---2-5- ------1--------2235579766652211111111111111---1121246611142------------------------------2-1216----------2-----------------------------------------------------------------------------------2----83991 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 313 STR:RPRED 96.9 SQ:SECSTR ##########cTTcccccccTTTcccccGGGcccccEEcccccccEEEEETTEEEEEEcEETEEETcEEEEEccccEEEEEEEccccccTTHHHHcTTccccEEEEEEEEETTEEEEEEEEccTTcccEEEEEEEEccccTTccEEEEEEEEEcTTccccccccEEEEcTTccEEEEEcccTTcEEEEEccTTTccccTccEEEEccccccccEEEEEEEEETTEEEEEEEEcccccGGGcccEEEEEEEccTTcccccTTcccGGGTccEEEEcccccEEEEEEEEEETEEEEEEEEEETTTTTEEEEEEEEEEETTccEcc PSIPRED ccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccEEEEEEccccccccEEEEEEccccccEEcccEEcccccccccccccccccEEccEEEEEccEEEEEEEEccccccccEEEEEEcccccccccccccEEEcccccccccccccEEEEcccccEEEEEccccccEEEEEEcHHHccccccEEEEEEccccccccccEEEEEEccEEEEEEEccccccccccccEEEEEEEcccccccccccccccccccccEEEcccccEEEccccccccccEEEEEEEccccccccEEEEEEEEEEcccccc //