[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : acuB
DDBJ      :acuB         component of the acetoin degradation regulation pathway
Swiss-Prot:ACUB_BACSU   RecName: Full=Acetoin utilization protein acuB;

Homologs  Archaea  20/68 : Bacteria  201/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.1.10d.37.1d.58.18
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->56 2ef7B PDBj 3e-05 41.5 %
:BLT:PDB   27->130 2o16B PDBj 8e-12 32.7 %
:RPS:PDB   1->128 2d4zA PDBj 1e-16 16.4 %
:RPS:SCOP  1->135 2o16A3  d.37.1.1 * 5e-28 31.2 %
:RPS:SCOP  163->206 2b7oA1  c.1.10.8 * 1e-04 39.5 %
:HMM:SCOP  1->56 1y5hA2 d.37.1.1 * 1.4e-12 42.9 %
:HMM:SCOP  62->138 2d4zA2 d.37.1.1 * 1.5e-12 36.4 %
:HMM:SCOP  135->208 2f06A2 d.58.18.11 * 0.00045 20.0 %
:RPS:PFM   10->123 PF00478 * IMPDH 3e-06 29.0 %
:HMM:PFM   3->56 PF00571 * CBS 1.7e-17 38.9 54/57  
:HMM:PFM   74->125 PF00571 * CBS 6.1e-14 38.5 52/57  
:HMM:PFM   139->186 PF01842 * ACT 3.3e-06 26.1 46/66  
:BLT:SWISS 1->214 ACUB_BACSU e-122 100.0 %
:REPEAT 2|3->53|74->123

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14948.1 GT:GENE acuB GT:PRODUCT component of the acetoin degradation regulation pathway GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3040751..3041395 GB:FROM 3040751 GB:TO 3041395 GB:DIRECTION + GB:GENE acuB GB:PRODUCT component of the acetoin degradation regulation pathway GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10368162, 10809684, 11274109, 16855235, 7934817; Product type f: factor GB:PROTEIN_ID CAB14948.1 GB:DB_XREF GOA:P39066 InterPro:IPR000644 SubtiList:BG10368 UniProtKB/Swiss-Prot:P39066 GB:GENE:GENE acuB LENGTH 214 SQ:AASEQ MIVEQIMKRDVITLTKTDTLETAICKLKEFHIRHLPVVDEERHVIGMITDRDMKQASPSIFEENKRSLFLTRSVDSIMKKDVVCAHPLDFVEEISAVFYEHGIGCLPVVHHQKLIGILTKTDLLRTFVKLTGADQPGSQIEIKVNDITKSLAEISSLCQDLQVKILSVLVYPHDDPGVKVLVFRVKTMNPLPFLQALQRNGHHVVWPSEQRDLL GT:EXON 1|1-214:0| SW:ID ACUB_BACSU SW:DE RecName: Full=Acetoin utilization protein acuB; SW:GN Name=acuB; OrderedLocusNames=BSU29700; SW:KW Acetoin catabolism; CBS domain; Complete proteome; Repeat;Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->214|ACUB_BACSU|e-122|100.0|214/214| GO:SWS:NREP 2 GO:SWS GO:0045150|"GO:acetoin catabolic process"|Acetoin catabolism| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| NREPEAT 1 REPEAT 2|3->53|74->123| BL:PDB:NREP 2 BL:PDB:REP 16->56|2ef7B|3e-05|41.5|41/120| BL:PDB:REP 27->130|2o16B|8e-12|32.7|98/135| RP:PDB:NREP 1 RP:PDB:REP 1->128|2d4zA|1e-16|16.4|128/169| RP:PFM:NREP 1 RP:PFM:REP 10->123|PF00478|3e-06|29.0|100/459|IMPDH| HM:PFM:NREP 3 HM:PFM:REP 3->56|PF00571|1.7e-17|38.9|54/57|CBS| HM:PFM:REP 74->125|PF00571|6.1e-14|38.5|52/57|CBS| HM:PFM:REP 139->186|PF01842|3.3e-06|26.1|46/66|ACT| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00478|IPR001093| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00478|IPR001093| RP:SCP:NREP 2 RP:SCP:REP 1->135|2o16A3|5e-28|31.2|128/130|d.37.1.1| RP:SCP:REP 163->206|2b7oA1|1e-04|39.5|43/449|c.1.10.8| HM:SCP:REP 1->56|1y5hA2|1.4e-12|42.9|56/0|d.37.1.1|1/2|CBS-domain| HM:SCP:REP 62->138|2d4zA2|1.5e-12|36.4|77/0|d.37.1.1|2/2|CBS-domain| HM:SCP:REP 135->208|2f06A2|0.00045|20.0|70/0|d.58.18.11|1/1|ACT-like| OP:NHOMO 301 OP:NHOMOORG 224 OP:PATTERN -----------------------1-111----2-2321-1213---1------21111--1------- --------------------------------------11-------------------------1----------------2-----11-1-1------11--2---1-------------------------1-11111------1-1-----------------1-2-------------1112212--212222222222222221111112221221111------2-1------------------------------1--------------1111---11111111111111-------------1-111-1111-1---------------11---------1--1111-113-111-----------------------1--1-------------------------1-------1-11---1-------------------------------------------------------------------------------------1---------111-------------------1-1-------------1----2312232254223-1-1----1-111112-5---------------------------11------1-1111111--111111--11-----11-------------------------------------------------------------------------------------------------------1---1---------------11111-1-----1111--------1-------------111111111111111----------------1-11--11-------------------------------------1---32333--- ----12-------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 199 STR:RPRED 93.0 SQ:SECSTR ccTTcccccccccEETTccHHHHHHHHHHccccEEEEEccTTTEEEEEEHHHHHHHHHHHHHTTccccccccTTcccEEcccccccTTccHHHHHHHHHHHTccEEEEEETTEEEEEEEHHHHHHHHHHHHTTcccGGGcEEEEcccTTHHHHHHHHHHHTTccEEEEEEEcccccccEEEEEEEcccccHHHHHHHHH############### DISOP:02AL 214-215| PSIPRED ccHHHccccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHHHccccccccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEcccHHHHHHHHHHcccccccHHHHcccc //