[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : adaB
DDBJ      :adaB         O6-methylguanine-DNA methyltransferase
Swiss-Prot:ADAB_BACSU   RecName: Full=Methylated-DNA--protein-cysteine methyltransferase;         EC=2.1.1.63;AltName: Full=O-6-methylguanine-DNA alkyltransferase;

Homologs  Archaea  16/68 : Bacteria  698/915 : Eukaryota  29/199 : Viruses  1/175   --->[See Alignment]
a.4.2c.55.7
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->168 1sfeA PDBj 4e-18 45.1 %
:RPS:PDB   7->168 1eh6A PDBj 2e-36 20.9 %
:RPS:SCOP  7->84 1sfeA2  c.55.7.1 * 4e-14 14.3 %
:RPS:SCOP  89->168 1eh6A1  a.4.2.1 * 6e-27 30.0 %
:HMM:SCOP  6->87 1sfeA2 c.55.7.1 * 1e-09 27.2 %
:HMM:SCOP  88->171 1sfeA1 a.4.2.1 * 6.3e-32 56.0 %
:RPS:PFM   91->168 PF01035 * DNA_binding_1 1e-18 48.7 %
:HMM:PFM   89->170 PF01035 * DNA_binding_1 1.3e-30 51.2 82/85  
:HMM:PFM   7->86 PF02870 * Methyltransf_1N 7.1e-22 22.7 75/77  
:BLT:SWISS 1->179 ADAB_BACSU 9e-97 100.0 %
:PROS 139->145|PS00374|MGMT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11958.1 GT:GENE adaB GT:PRODUCT O6-methylguanine-DNA methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 204351..204890 GB:FROM 204351 GB:TO 204890 GB:DIRECTION + GB:GENE adaB GB:PRODUCT O6-methylguanine-DNA methyltransferase GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 1744039, 2120677, 7565865, 8376346; Product type e: enzyme GB:PROTEIN_ID CAB11958.1 GB:DB_XREF GOA:P19220 HSSP:1SFE InterPro:IPR011991 SubtiList:BG10167 UniProtKB/Swiss-Prot:P19220 GB:GENE:GENE adaB LENGTH 179 SQ:AASEQ METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEWARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPYGQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTLLLDLEKRASSEMDVPH GT:EXON 1|1-179:0| SW:ID ADAB_BACSU SW:DE RecName: Full=Methylated-DNA--protein-cysteine methyltransferase; EC=2.1.1.63;AltName: Full=O-6-methylguanine-DNA alkyltransferase; SW:GN Name=adaB; OrderedLocusNames=BSU01820; SW:KW Complete proteome; DNA damage; DNA repair; Methyltransferase;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->179|ADAB_BACSU|9e-97|100.0|179/179| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 139->145|PS00374|MGMT|PDOC00320| SEG 121->132|aavravgaaiga| BL:PDB:NREP 1 BL:PDB:REP 47->168|1sfeA|4e-18|45.1|122/165| RP:PDB:NREP 1 RP:PDB:REP 7->168|1eh6A|2e-36|20.9|158/168| RP:PFM:NREP 1 RP:PFM:REP 91->168|PF01035|1e-18|48.7|78/85|DNA_binding_1| HM:PFM:NREP 2 HM:PFM:REP 89->170|PF01035|1.3e-30|51.2|82/85|DNA_binding_1| HM:PFM:REP 7->86|PF02870|7.1e-22|22.7|75/77|Methyltransf_1N| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01035|IPR014048| GO:PFM GO:0006281|"GO:DNA repair"|PF01035|IPR014048| RP:SCP:NREP 2 RP:SCP:REP 7->84|1sfeA2|4e-14|14.3|77/81|c.55.7.1| RP:SCP:REP 89->168|1eh6A1|6e-27|30.0|80/90|a.4.2.1| HM:SCP:REP 6->87|1sfeA2|1e-09|27.2|81/0|c.55.7.1|1/1|Methylated DNA-protein cysteine methyltransferase domain| HM:SCP:REP 88->171|1sfeA1|6.3e-32|56.0|84/0|a.4.2.1|1/1|Methylated DNA-protein cysteine methyltransferase, C-terminal domain| OP:NHOMO 1025 OP:NHOMOORG 744 OP:PATTERN ------1-111111111---------------1---------------11111--------------- 12311---1111-1-1111-1211121111112111-2221211221212212--1-111-111--222211111111-121------111111111--112111312-3--------------1-1111---1--111111111-2--111----1---------1111--------------------111222222222122222222222222211131223233323211111111111111111111111-11-12121111111111-11-1111111111111111111111-------------1111--11111121111111121111211-11-21111---1-222-1111-11111-111113331-1111212111111111111111111112-11111111131-233322122222111-1123111122311111111111-1111------------1-111-2---11------11311322132222222112122221111115222222--22312112111111111--1131111111112-11-2-1-1---1-1--1-11111-111111121-12--111111111111111112--11223211-111111122122112111-111111---1--1------22221312222222212-222222222222222222232323112222222222222222212222222--222222212222--11-1---2221-121211111111111111122212121112233322333222221111111111111-111211111-111122111111111111--11111111--------111-------1----------1-1-----1-1-11111-12 ----11-------1-------------------------------------------------1--1--1-11-111111111111------------------------------------------------------------------------1----1---1--4122-----------1--------1---- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 177 STR:RPRED 98.9 SQ:SECSTR EETTTTccEEEEEccTTccEEEEEETTEEEEEEEccccTccccccccccHHHHHHHHHcccHHHHHHcGGGGGGccccccccHHHHcccHHHHHHHHHHHHccTTccEEHHHHHHHTTcTTcHHHHHHHTTcccccTTccGGGEEcTTccccccTTcHHHHHHHHHHTTTccccEEE## DISOP:02AL 1-2, 173-179| PSIPRED ccccccEEEEEEEcccccEEEEEEccccEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccEEcHHHHHHHHcccccHHHHHHHHHHcccccccccEEEEccccccccccccHHHHHHHHHHHHHHcccccccc //