[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : adhA
DDBJ      :adhA         putative dehydrogenase
Swiss-Prot:ADHA_BACSU   RecName: Full=Probable formaldehyde dehydrogenase adhA;         EC=1.1.1.-;

Homologs  Archaea  36/68 : Bacteria  628/915 : Eukaryota  177/199 : Viruses  1/175   --->[See Alignment]
b.35.1c.2.1
:349 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   15->349 1uufA PDBj 5e-78 48.8 %
:RPS:PDB   5->347 2cf5A PDBj 7e-57 39.8 %
:RPS:SCOP  12->175 1uufA1  b.35.1.2 * 6e-26 39.4 %
:RPS:SCOP  151->314 1piwA2  c.2.1.1 * 8e-68 36.6 %
:RPS:SCOP  319->349 1uufA1  b.35.1.2 * 1e-06 71.0 %
:HMM:SCOP  7->194 1p0fA1 b.35.1.2 * 2.1e-50 39.8 %
:HMM:SCOP  151->315 1q1nA2 c.2.1.1 * 3.7e-48 41.2 %
:RPS:PFM   33->139 PF08240 * ADH_N 5e-07 33.7 %
:RPS:PFM   188->304 PF00107 * ADH_zinc_N 7e-13 40.2 %
:HMM:PFM   31->146 PF08240 * ADH_N 1.3e-29 39.3 107/109  
:HMM:PFM   188->310 PF00107 * ADH_zinc_N 1.9e-29 33.3 123/130  
:BLT:SWISS 1->349 ADHA_BACSU 0.0 100.0 %
:PROS 65->79|PS00059|ADH_ZINC
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14643.2 GT:GENE adhA GT:PRODUCT putative dehydrogenase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2756312..2757361 GB:FROM 2756312 GB:TO 2757361 GB:DIRECTION + GB:GENE adhA GB:PRODUCT putative dehydrogenase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB14643.2 GB:DB_XREF GOA:C0SPA5 InterPro:IPR002328 SubtiList:BG12562 UniProtKB/Swiss-Prot:C0SPA5 GB:GENE:GENE adhA LENGTH 349 SQ:AASEQ MCNQHQTRVLSVSHAKAKFEQTTIERRGLRPHDVLIDIKFSGICHSDIHSAFDEWGGGIFPMVPGHEIAGVVTAVGTKVTKLAVGDRVGVGCFVDSCGECEYCLNAEEQFCTKGVVQTYNSVDYDGNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGITTYSPLKHWNVGPGKKVAIVGVGGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGANHYFATSDPATFTALAGRFDVILNTVSANLDVDAYLSMLRIDGTLVSVGAPAKPDTYSVFSLIMGRRSIAGSLVGGIQETQEMLDFAAEHGIEPKIEVIGADQVDEAYERILRSDVRYRFVIDISTL GT:EXON 1|1-349:0| SW:ID ADHA_BACSU SW:DE RecName: Full=Probable formaldehyde dehydrogenase adhA; EC=1.1.1.-; SW:GN Name=adhA; OrderedLocusNames=BSU27010; SW:KW Complete proteome; Metal-binding; Oxidoreductase; Stress response;Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->349|ADHA_BACSU|0.0|100.0|349/349| GO:SWS:NREP 4 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006950|"GO:response to stress"|Stress response| PROS 65->79|PS00059|ADH_ZINC|PDOC00058| SEG 69->84|agvvtavgtkvtklav| BL:PDB:NREP 1 BL:PDB:REP 15->349|1uufA|5e-78|48.8|328/339| RP:PDB:NREP 1 RP:PDB:REP 5->347|2cf5A|7e-57|39.8|342/352| RP:PFM:NREP 2 RP:PFM:REP 33->139|PF08240|5e-07|33.7|98/108|ADH_N| RP:PFM:REP 188->304|PF00107|7e-13|40.2|117/128|ADH_zinc_N| HM:PFM:NREP 2 HM:PFM:REP 31->146|PF08240|1.3e-29|39.3|107/109|ADH_N| HM:PFM:REP 188->310|PF00107|1.9e-29|33.3|123/130|ADH_zinc_N| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08240|IPR013154| GO:PFM GO:0008270|"GO:zinc ion binding"|PF00107|IPR013149| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00107|IPR013149| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00107|IPR013149| RP:SCP:NREP 3 RP:SCP:REP 12->175|1uufA1|6e-26|39.4|160/178|b.35.1.2| RP:SCP:REP 151->314|1piwA2|8e-68|36.6|164/168|c.2.1.1| RP:SCP:REP 319->349|1uufA1|1e-06|71.0|31/178|b.35.1.2| HM:SCP:REP 7->194|1p0fA1|2.1e-50|39.8|176/0|b.35.1.2|1/1|GroES-like| HM:SCP:REP 151->315|1q1nA2|3.7e-48|41.2|165/0|c.2.1.1|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 3384 OP:NHOMOORG 842 OP:PATTERN 221-1-37ABAB9CB5-533131-8--11151----------------1-11-----1---4221-32 437-31133321-137544-49228H44444677A87ACA263371211321536313--21238-866531----1----16-1--------1-----1-2-2-31111--------------111---1-----14411---274334222--11----1-12-53342------------2-1--11-52444444445245343474333333412116-133333213133333333333333-22421-3----4---33221-2--22421111111112--111111112121111111111111222---222-----5221222221132--1-----1---------1-11---1---1--15233222-----646673145543522442343334-121-22-2224-655475BA8568313123341-115324444444435531-21------------------------------24222122225335345424466584444243662663--22922252323231351-111--1-11111212-112-1------------1211-222-448526111----111111111211111-----34--111331441221121--211111--111----1--------3712-246668688866-675567765768666566424343221436364744662423622343324--211222122222---1111113222211451113-1---11-11-2232314-1-4133331434244432322211212111----------11---23313113334222---2332211-----------------31--1-------1------1--1-1-1-121- --11862-21---17EIJEKGKIRQOK7736779989A8A8A9767CBFPIMYWCE8969786A936767554487958765557777-6R9I5B39672748A8E-4269-211-2-11-1-1311C-5I4-62621-141131211---11113148572-511-215546-815519323225ELQGEG31WTNK4 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 349 STR:RPRED 100.0 SQ:SECSTR cccccEEEEEEEccTTccEEEEEEEcccccTTEEEEEEEEEEEcHHHHHHHTcTTTccccccccccEEEEEEEEEccccccccTTcEEEEccEEEcccccHHHHTTcGGGcTTcEcETTTcccTTcccccccccccEEEEGGGEEEccccccHHHHTGGGTHHHHHHHHHHHTcTTcTTEEEEEcccHHHHHHHHHHHHHTcEEEEEEccTTHHHHHTTcccccEEETTcHHHHHHcTTTEEEEEEccccccccHHHHTTEEEEEEEEEcccccccccccHHHHHHHTcEEEEcccccHHHHHHHHHHHHHTTccccEEEEEGGGHHHHHHHHHTTccccEEEEETTcc PSIPRED ccccEEEEEEEEEcccccEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEcccccccccEEccccccEEEEEEcccccccccccEEEEccccccccccHHHccccccccccccccccccccccccccccccEEEEEEcHHHEEEccccccHHHHHccccHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHcccEEEEcccHHHHHHHcccccEEEEccccHHHHHHHHHHHccccEEEEEcccccccEEcHHHHHHccEEEEEEEEccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHcccccEEEEEEEEcc //