[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : alkA
DDBJ      :alkA         DNA-3-methyladenine glycosylase
Swiss-Prot:3MGA_BACSU   RecName: Full=DNA-3-methyladenine glycosylase;         EC=3.2.2.21;AltName: Full=3-methyladenine-DNA glycosidase;

Homologs  Archaea  24/68 : Bacteria  316/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
a.96.1d.129.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   83->284 2jhjB PDBj 3e-16 27.7 %
:RPS:PDB   9->303 3cwsC PDBj 2e-48 24.3 %
:RPS:SCOP  49->125 1ebmA2  d.129.1.2 * 9e-08 21.6 %
:RPS:SCOP  118->300 1dizA1  a.96.1.3 * 9e-33 30.1 %
:HMM:SCOP  63->127 1ebmA2 d.129.1.2 * 0.00079 27.7 %
:HMM:SCOP  117->302 1mpgA1 a.96.1.3 * 6e-43 30.7 %
:RPS:PFM   78->134 PF07934 * OGG_N 2e-10 50.0 %
:RPS:PFM   138->282 PF00730 * HhH-GPD 3e-06 32.0 %
:HMM:PFM   137->287 PF00730 * HhH-GPD 2.1e-21 24.8 109/121  
:HMM:PFM   43->134 PF07934 * OGG_N 1.8e-15 30.2 86/117  
:BLT:SWISS 1->303 3MGA_BACSU e-180 100.0 %
:PROS 234->258|PS00516|ALKYLBASE_DNA_GLYCOS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11956.1 GT:GENE alkA GT:PRODUCT DNA-3-methyladenine glycosylase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(202547..203458) GB:FROM 202547 GB:TO 203458 GB:DIRECTION - GB:GENE alkA GB:PRODUCT DNA-3-methyladenine glycosylase GB:FUNCTION 16.6: Maintain 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 7565865, 8376346; Product type e: enzyme GB:PROTEIN_ID CAB11956.1 GB:DB_XREF GOA:P37878 InterPro:IPR012904 SubtiList:BG10165 UniProtKB/Swiss-Prot:P37878 GB:GENE:GENE alkA LENGTH 303 SQ:AASEQ MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITKVIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYEMAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSIEWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNFKDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEILEISVPWKEWQSYATFYLWRVLY GT:EXON 1|1-303:0| SW:ID 3MGA_BACSU SW:DE RecName: Full=DNA-3-methyladenine glycosylase; EC=3.2.2.21;AltName: Full=3-methyladenine-DNA glycosidase; SW:GN Name=alkA; OrderedLocusNames=BSU01800; SW:KW Complete proteome; DNA damage; DNA repair; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|3MGA_BACSU|e-180|100.0|303/303| GO:SWS:NREP 3 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| PROS 234->258|PS00516|ALKYLBASE_DNA_GLYCOS|PDOC00447| BL:PDB:NREP 1 BL:PDB:REP 83->284|2jhjB|3e-16|27.7|195/291| RP:PDB:NREP 1 RP:PDB:REP 9->303|3cwsC|2e-48|24.3|272/281| RP:PFM:NREP 2 RP:PFM:REP 78->134|PF07934|2e-10|50.0|56/115|OGG_N| RP:PFM:REP 138->282|PF00730|3e-06|32.0|125/144|HhH-GPD| HM:PFM:NREP 2 HM:PFM:REP 137->287|PF00730|2.1e-21|24.8|109/121|HhH-GPD| HM:PFM:REP 43->134|PF07934|1.8e-15|30.2|86/117|OGG_N| GO:PFM:NREP 4 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF07934|IPR012904| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF07934|IPR012904| GO:PFM GO:0008534|"GO:oxidized purine base lesion DNA N-glycosylase activity"|PF07934|IPR012904| GO:PFM GO:0006284|"GO:base-excision repair"|PF00730|IPR003265| RP:SCP:NREP 2 RP:SCP:REP 49->125|1ebmA2|9e-08|21.6|74/124|d.129.1.2| RP:SCP:REP 118->300|1dizA1|9e-33|30.1|173/183|a.96.1.3| HM:SCP:REP 63->127|1ebmA2|0.00079|27.7|65/127|d.129.1.2|1/1|TATA-box binding protein-like| HM:SCP:REP 117->302|1mpgA1|6e-43|30.7|176/183|a.96.1.3|1/1|DNA-glycosylase| OP:NHOMO 482 OP:NHOMOORG 393 OP:PATTERN ---------------1-------12221-221-----------1--11-1111-1111111-----1- 112------------1111-11--111111111111-111-1---1-1-11-1-------1-1-----1----------11--------------------1---2-1-1--------------1-----------111-----1--11111--------------2--1----------------------111121222212222221-11122221111-11------21---------------1---1----------------------------------------------------------------------1-11-------1--------1111--11---------------1111---1--1--1------11--11---1-1------------11-111-1--1--11--1-111-1--11-----------------------1--1-----------------------------------2221-2222221223233222222222211222112332121121111222211-1-1-------1111111-1-----1---------1---------2----------------------------221-----------1111-1111111111111-------------1111-111111111111-111111111111111111111111-11111111111111111111111111-----------------1----------111----------------------------11112211112111-------------1--1------11--1-111111111---------1122-----------------------------------------------1- --11----------1-1111111111111--1--1--------1-1-11-1111-11-----1-1---------------------11---111-11111-11-11--2---------------------------------------------------------------------15----12224-4-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 97.4 SQ:SECSTR ########cEEEEccccccHHHHHHHHHHHccTTTEEEccccEEEEEEETTEEEEEEEEEETTTTEEEEEEcGGGGGETcGHHHHHHHHHHHTTTTccHHHHHGGGcccTTccccccTcccccccccccHHHHHHHHHHTccccHHHHHHHHHHHHHHHcEEccEccTTcEEcccHHHHHTccHHHHHHTTccHHHHHHHHHHHHHHHHTccccccTTcccHHHHHHHHTTcTTccHHHHHHHHHHHccccccccTTcHHHHHHHHHHHHHcTTccHHHHHHHHGGGTTcHHHHHHHHHTccc DISOP:02AL 302-304| PSIPRED ccccccccEEEEEccccccHHHHHHHHHcccccccEEEcccEEEEEEEEccccEEEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEccHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHc //