[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : alsR
DDBJ      :alsR         transcriptional regulator (LysR family)
Swiss-Prot:ALSR_BACSU   RecName: Full=HTH-type transcriptional regulator alsR;AltName: Full=Als operon regulatory protein;

Homologs  Archaea  5/68 : Bacteria  753/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->221 1iz1B PDBj 1e-21 26.7 %
:RPS:PDB   1->224 1b9nB PDBj 6e-35 5.6 %
:RPS:SCOP  2->89 1ixcA1  a.4.5.37 * 6e-24 45.8 %
:RPS:SCOP  91->294 1i69A  c.94.1.1 * 4e-32 23.7 %
:HMM:SCOP  1->112 1b9mA1 a.4.5.8 * 1.8e-25 41.0 %
:HMM:SCOP  85->287 1uthA_ c.94.1.1 * 4.3e-36 28.0 %
:RPS:PFM   3->62 PF00126 * HTH_1 2e-12 53.3 %
:RPS:PFM   90->245 PF03466 * LysR_substrate 5e-20 31.8 %
:HMM:PFM   87->286 PF03466 * LysR_substrate 5.4e-46 28.8 198/209  
:HMM:PFM   3->62 PF00126 * HTH_1 6.9e-27 55.0 60/60  
:BLT:SWISS 1->302 ALSR_BACSU e-174 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15619.1 GT:GENE alsR GT:PRODUCT transcriptional regulator (LysR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3711498..3712406 GB:FROM 3711498 GB:TO 3712406 GB:DIRECTION + GB:GENE alsR GB:PRODUCT transcriptional regulator (LysR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10809684, 10972805, 12363365, 15978075, 17183216, 7685336; Product type r : regulator GB:PROTEIN_ID CAB15619.1 GB:DB_XREF GOA:Q04778 InterPro:IPR011991 SubtiList:BG10470 UniProtKB/Swiss-Prot:Q04778 GB:GENE:GENE alsR LENGTH 302 SQ:AASEQ MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAAGEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKESITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMTFVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDAGT GT:EXON 1|1-302:0| SW:ID ALSR_BACSU SW:DE RecName: Full=HTH-type transcriptional regulator alsR;AltName: Full=Als operon regulatory protein; SW:GN Name=alsR; OrderedLocusNames=BSU36020; SW:KW Acetoin biosynthesis; Complete proteome; DNA-binding; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->302|ALSR_BACSU|e-174|100.0|302/302| GO:SWS:NREP 4 GO:SWS GO:0045151|"GO:acetoin biosynthetic process"|Acetoin biosynthesis| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 1->221|1iz1B|1e-21|26.7|221/294| RP:PDB:NREP 1 RP:PDB:REP 1->224|1b9nB|6e-35|5.6|213/245| RP:PFM:NREP 2 RP:PFM:REP 3->62|PF00126|2e-12|53.3|60/60|HTH_1| RP:PFM:REP 90->245|PF03466|5e-20|31.8|154/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 87->286|PF03466|5.4e-46|28.8|198/209|LysR_substrate| HM:PFM:REP 3->62|PF00126|6.9e-27|55.0|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 2->89|1ixcA1|6e-24|45.8|83/84|a.4.5.37| RP:SCP:REP 91->294|1i69A|4e-32|23.7|194/206|c.94.1.1| HM:SCP:REP 1->112|1b9mA1|1.8e-25|41.0|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 85->287|1uthA_|4.3e-36|28.0|200/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 9467 OP:NHOMOORG 769 OP:PATTERN -----------------------1-----------111---------------1-------------- 6663S213887311F7611-15224M1111137676BPZc-E4A72121211CA53-6--2241I7TLSC6-333123336C5111112221-211---11811251225---------------1---1----1-46634---31633644534441111113438866211111111111122221--153IEEEEEEEE7DCEEFEC5FCFHECF254B361677775Qd2334444344333446335845567844634FG449745832332334433333332222222222234343343444442213332225-55DF555678646537994222A41-187711JJ552212632121--42239444-----37UKP668AI9B8AAAAA9BA9AK-A9G98XAMGN4-cPPMPQFidRSRZP653DGM8A9BANNEDEEEEEEBFGA8668------------------------------2CO73Q*rc*w*****YVWXUss**cbccNX*j*p**x14daRHJKKH*PnC*TEOA8446JA33555354446CBA231323114A334-4145353519847AC13--2------------------1-1-CBKFG8B9R7FIDKJLMJBGILGGHKMOHHNI2-135491-----QHNM8OKLNOJLIJHML-OLKLMIILIKOIOIJKKJIileQO8DERJQJPNRPPOOMQMJNcEGGHHHH7-F9AABBA9BBAB--1511111354348KQi555949355554566TVSUVFO7AAS9ggjiavmpPloqmCWTW3322223236CKIREEEEEKQPJJGGHGJGGBBB43331-5222------------1-------------------------------------3A1 -------------4------------------------------------------------------------------------------------------------------------------------------------------------9----2-1----7--3-1--------13--F-----4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 94.4 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccHEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTccTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEEEEcGGGccHHHHTTccEEEEEEEEEEEEcccEEEEEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEEcHHHHHHHHHHTccEEEEEGGccTTTcTTcEEEEccTTcccEEEEEEEETTcccHHHHHHH################# DISOP:02AL 85-86, 291-302| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccEEEEEEcccEEEEEcccccccccccccHHHHccccEEEEccccccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccc //