[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ampS
DDBJ      :ampS         aminopeptidase
Swiss-Prot:AMPS_BACSU   RecName: Full=Aminopeptidase ampS;         EC=3.4.11.-;

Homologs  Archaea  13/68 : Bacteria  239/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.60.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->409 1zjcA PDBj e-110 47.9 %
:RPS:PDB   3->409 2ayiA PDBj e-134 44.2 %
:RPS:SCOP  3->409 2ayiA1  e.60.1.1 * e-134 44.2 %
:HMM:SCOP  3->410 2ayiA1 e.60.1.1 * 3.9e-154 49.0 %
:RPS:PFM   7->408 PF02073 * Peptidase_M29 5e-98 51.3 %
:HMM:PFM   1->408 PF02073 * Peptidase_M29 4.3e-168 55.2 397/398  
:BLT:SWISS 1->410 AMPS_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13318.1 GT:GENE ampS GT:PRODUCT aminopeptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1514997..1516229) GB:FROM 1514997 GB:TO 1516229 GB:DIRECTION - GB:GENE ampS GB:PRODUCT aminopeptidase GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16088219, 9362117; Product type e: enzyme GB:PROTEIN_ID CAB13318.1 GB:DB_XREF GOA:P39762 InterPro:IPR000787 SubtiList:BG10986 UniProtKB/Swiss-Prot:P39762 GB:GENE:GENE ampS LENGTH 410 SQ:AASEQ MDSFSQKLNTYAQLAVEVGVNVQKGQYVVVNASTDVRDFVRLIVKHAYEKGAKNVTVNWQDDEVAKLKYELAPFEAFEEYPEWEAKGREELAKNGAAFISVVSSNPDLLKGIDSKRIAAFQKAAGKALHTYRQYIQSDKVSWTVVGAASAGWAHKVFPGKSEEEAIHLLWEEIFKATRVNEDNPVQAWINHDQNLHEKVDHLNERHYAALHYQAEGTDLTIKLPRKHVWAGAGSVNESGHEFMANMPTEEVFTLPQKDGVDGVVSSTKPLSYGGNIIENFTLTFENGRIVDIKAEKGEDILKELVETDEGSHYLGEVALVPYDSPISQSNILFYNTLFDENASNHLAIGSAYAFNIEGGKQMSREELVKEGLNESITHVDFMIGSKDMNIDGITADGKREPIFRNGNWAF GT:EXON 1|1-410:0| SW:ID AMPS_BACSU SW:DE RecName: Full=Aminopeptidase ampS; EC=3.4.11.-; SW:GN Name=ampS; OrderedLocusNames=BSU14450; SW:KW Aminopeptidase; Complete proteome; Hydrolase; Metalloprotease;Protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->410|AMPS_BACSU|0.0|100.0|410/410| GO:SWS:NREP 4 GO:SWS GO:0004177|"GO:aminopeptidase activity"|Aminopeptidase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| BL:PDB:NREP 1 BL:PDB:REP 3->409|1zjcA|e-110|47.9|407/413| RP:PDB:NREP 1 RP:PDB:REP 3->409|2ayiA|e-134|44.2|396/397| RP:PFM:NREP 1 RP:PFM:REP 7->408|PF02073|5e-98|51.3|378/382|Peptidase_M29| HM:PFM:NREP 1 HM:PFM:REP 1->408|PF02073|4.3e-168|55.2|397/398|Peptidase_M29| GO:PFM:NREP 2 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF02073|IPR000787| GO:PFM GO:0006508|"GO:proteolysis"|PF02073|IPR000787| RP:SCP:NREP 1 RP:SCP:REP 3->409|2ayiA1|e-134|44.2|396/397|e.60.1.1| HM:SCP:REP 3->410|2ayiA1|3.9e-154|49.0|406/0|e.60.1.1|1/1|Thermophilic metalloprotease-like| OP:NHOMO 325 OP:NHOMOORG 253 OP:PATTERN 111-11------------------23322222------------------------------------ 11------------------------------------------------------------1---------------1---1-------------------------1------------------------------1111121-------------------------------------33322--112122222322233233312111123211121222222227321111111111111111111----11---------1111111----11111-11--11111111111-------------1111111111121-2111111111111--1222-1-11-----2211--1-1----1--1-------11111--11111--1---1111111-111-1111111-11-11111111111111--------------111111111111---------------------------------------------------------------------------------------------------------------1-1-111-12111-11111-1-1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------111111111-1-------------------------1--11-1----1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 407 STR:RPRED 99.3 SQ:SECSTR ##ccHHHHHHHHHHHHHTTTcccTTcEEEEEEcTTcHHHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHHccTTcTTcccHHHHHHHHHHHHTTcEEEEEEcccGGGcTTccHHHHHHHHHHHHHHHHHHHHHHHTTccccccEEcccTTTHHHHcccccHHHHHHHHHHHHHHHTTcccHccHHHHHHHHHHHHHHHHHHHHTTccEEEEEETTEEEEEEccTTcccEEcccccccccccccccccccEEEcccTTcEEEEEEccccEEETTEEEcccEEEEETTEEEEEEccccHHHHHHHTTcccGGGcEEEEEcccTTcHHHHHTcccccHHHHHTTccEEEEEcccGGGccccGGccHccHHHHTccccccEEEEEcccTTcEEEEEcTTccEEEEEETTEEc# DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccHHHHccccHHHHHHHHHHHHcccEEEEEEEccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEcccEEEcccccccccccccccccccccEEEccccccEEEEEEEEEEcccccEEEccEEEEEEccEEEEEEcccHHHHHHHHHcccccHHEEEEEEEcccccccccccEEEEEEEEccccEEEEEEcccccccccccccccHHHHHHcccccccEEEEEEEEcccEEEEEEEEcccEEEEEEcccccc //