[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : aroB
DDBJ      :aroB         3-dehydroquinate synthase
Swiss-Prot:AROB_BACSU   RecName: Full=3-dehydroquinate synthase;         EC=4.2.3.4;

Homologs  Archaea  27/68 : Bacteria  805/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
e.22.1
:362 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->339 1xaiA PDBj 1e-59 38.3 %
:RPS:PDB   6->353 1dqsA PDBj 2e-61 33.7 %
:RPS:SCOP  10->353 1dqsA  e.22.1.1 * 6e-69 34.4 %
:HMM:SCOP  2->355 1dqsA_ e.22.1.1 * 1.5e-99 43.0 %
:RPS:PFM   18->322 PF01761 * DHQ_synthase 1e-74 49.7 %
:HMM:PFM   17->324 PF01761 * DHQ_synthase 1.7e-108 46.9 307/313  
:BLT:SWISS 1->362 AROB_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14186.1 GT:GENE aroB GT:PRODUCT 3-dehydroquinate synthase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2378012..2379100) GB:FROM 2378012 GB:TO 2379100 GB:DIRECTION - GB:GENE aroB GB:PRODUCT 3-dehydroquinate synthase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 6795181, 97285, 97286; Product type e: enzyme GB:PROTEIN_ID CAB14186.1 GB:DB_XREF GOA:P31102 HSSP:1DQS InterPro:IPR016037 SubtiList:BG10285 UniProtKB/Swiss-Prot:P31102 GB:GENE:GENE aroB LENGTH 362 SQ:AASEQ MKTLHVQTASSSYPVFIGQGIRKKACELLTSLNRPLTRIMFVTDEEVDRLYGDEMLHLLQEKWPVKKVTVPSGEQAKSMDMYTKLQSEAIRFHMDRSSCIIAFGGGVVGDLAGFVAATFMRGIDFIQMPTTLLAHDSAVGGKVAVNHPLGKNLIGAFYQPKAVLYDTDFLRSLPEKELRSGMAEVIKHAFIYDRAFLEELLNIHSLRDITNDQLNDMIFKGISIKASVVQQDEKEEGIRAYLNFGHTLGHAVEAEYGYGQITHGDAVALGMQFALYISEKTVGCEMDRKRLVSWLKSLGYPSQIRKETETSVLLNRMMNDKKTRGGKIQFIVLNELGKVADHTFSRNELESWLNKWRLEETS GT:EXON 1|1-362:0| SW:ID AROB_BACSU SW:DE RecName: Full=3-dehydroquinate synthase; EC=4.2.3.4; SW:GN Name=aroB; OrderedLocusNames=BSU22700; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Cytoplasm; Lyase; NAD. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->362|AROB_BACSU|0.0|100.0|362/362| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 10->339|1xaiA|1e-59|38.3|321/352| RP:PDB:NREP 1 RP:PDB:REP 6->353|1dqsA|2e-61|33.7|347/381| RP:PFM:NREP 1 RP:PFM:REP 18->322|PF01761|1e-74|49.7|302/312|DHQ_synthase| HM:PFM:NREP 1 HM:PFM:REP 17->324|PF01761|1.7e-108|46.9|307/313|DHQ_synthase| GO:PFM:NREP 2 GO:PFM GO:0003856|"GO:3-dehydroquinate synthase activity"|PF01761|IPR002658| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01761|IPR002658| RP:SCP:NREP 1 RP:SCP:REP 10->353|1dqsA|6e-69|34.4|343/381|e.22.1.1| HM:SCP:REP 2->355|1dqsA_|1.5e-99|43.0|351/388|e.22.1.1|1/1|Dehydroquinate synthase-like| OP:NHOMO 1071 OP:NHOMOORG 955 OP:PATTERN 11-1--1111111111-111111-------------------------------11-111-111---- 1111111111111111111-111131111111111112111222111111111111111132114121111111111111111-----11111111-111111122121211111111111111121121111111111112222113311111111111111111122421111111211111211111-111111111111111111111111111111111111111111111111111111111111111----------11----1--11-1111111111111111111111111111111111111111111111-11111222222312111111111111-11111111111111111111-11112111111111111112112211111111111111-11111111111-1111111111111111111111111111111111111111211-----------------------------11111111111111111111111111111111111111121111111111112111112111211111111111111-12-2----11----22221111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111211113211111111111111111111111111111111111111111111111111111221111--------1-1---------------------------1--1-111112 ------2-----1113222211211111111111111111111111121122212221111111-111-21211111-111-111111-23121111111132222-13--12------------------------------------------11-1----1---------2-211161111211312212211114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 97.2 SQ:SECSTR ##EccEEEETTEEEEEEcTTHHHHTHHHHHHHHccccEEEEEEETTTHHHHHHHHHHHHHHHcEEEEEEEcccGGGccHHHHHHHHHHHHTccccTTcEEEEEEcHHHHHHHHHHHHHGGGccEEEEEEccHHHHTTTcccEEEEEETTEEEEEEEEccccEEEEcGGGGGGccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHcccGGGHHHHHHHHHHHHHHHHHHHHHcTTcccGGGGGGTTHHHHHHHHHHHTTcTccHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHTTccHcTTccccHHHHHHHHTTcTTccTTccEEccEEETTEEccEEccHHHHHHHcc######## DISOP:02AL 361-362| PSIPRED ccEEEEccccccccEEEccHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEccHHHHcccccccccEEEcccccEEEEEcccccEEEEcHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHcc //