[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : aroK
DDBJ      :aroK         shikimate kinase
Swiss-Prot:AROK_BACSU   RecName: Full=Shikimate kinase;         Short=SK;         EC=2.7.1.71;

Homologs  Archaea  7/68 : Bacteria  688/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->153 2pt5B PDBj 6e-21 42.2 %
:RPS:PDB   12->177 2c95B PDBj 1e-09 15.5 %
:RPS:SCOP  10->177 1knqA  c.37.1.17 * 3e-14 14.7 %
:HMM:SCOP  12->177 1kagA_ c.37.1.2 * 5.7e-26 26.2 %
:RPS:PFM   20->172 PF01202 * SKI 2e-20 36.4 %
:HMM:PFM   20->177 PF01202 * SKI 7.6e-45 37.4 155/158  
:BLT:SWISS 1->186 AROK_BACSU e-108 100.0 %
:PROS 67->93|PS01128|SHIKIMATE_KINASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12109.2 GT:GENE aroK GT:PRODUCT shikimate kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 340025..340585 GB:FROM 340025 GB:TO 340585 GB:DIRECTION + GB:GENE aroK GB:PRODUCT shikimate kinase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 170268, 7612934; Product type e: enzyme GB:PROTEIN_ID CAB12109.2 GB:DB_XREF GOA:P37944 InterPro:IPR000623 SubtiList:BG10457 UniProtKB/Swiss-Prot:P37944 GB:GENE:GENE aroK LENGTH 186 SQ:AASEQ MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQIEKDFNMSIPEIFEKKGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGWDLYQPM GT:EXON 1|1-186:0| SW:ID AROK_BACSU SW:DE RecName: Full=Shikimate kinase; Short=SK; EC=2.7.1.71; SW:GN Name=aroK; Synonyms=aroI; OrderedLocusNames=BSU03150; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|AROK_BACSU|e-108|100.0|186/186| GO:SWS:NREP 8 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 67->93|PS01128|SHIKIMATE_KINASE|PDOC00868| BL:PDB:NREP 1 BL:PDB:REP 14->153|2pt5B|6e-21|42.2|135/165| RP:PDB:NREP 1 RP:PDB:REP 12->177|2c95B|1e-09|15.5|161/194| RP:PFM:NREP 1 RP:PFM:REP 20->172|PF01202|2e-20|36.4|151/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 20->177|PF01202|7.6e-45|37.4|155/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 10->177|1knqA|3e-14|14.7|163/171|c.37.1.17| HM:SCP:REP 12->177|1kagA_|5.7e-26|26.2|164/0|c.37.1.2|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 857 OP:NHOMOORG 757 OP:PATTERN -------------------------------------------1--22-1111--------------- 11111-11---1-11------111--------1----1--1---1---1---1-1--1-----1---11--11111112221111111111111----1111111111-1--------------11111111111----1-1111111111111111111111111111111111111111111111111-111111111--11-111-111111111111111111111111111111111111111111111-----11---1-----1--111111---1111111111111111111111111111111111---11111111111111111112111-111212-1-121-111211111-1111-11111111111111112241112222211111111111-22222112131-11111111111111111-11111111111111111-1111111-----------------------------11-111111111111111111111111111111121113111--21------11111--1111-111111111-32--1112-----2----212211121------1-1111111111111111111111111111111111111111111111111111111111-11--111111111121222222212122-222222122221222222111122222-1111111111111112222222211211121111222111111111111111111111111111111-11111111111112111111111111--1111111111111111111111111111111111111111111------------------1---------------------------1-------111 ------------------------1-111-11111111111-1-1------11111111---1------2----------------11-----------1-----1---------1-----1---2-1-131-11111--1---111--11--1---------1--------------1-----11313-4111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 95.7 SQ:SECSTR ########ccccEEEEEEcTTccHHHHHHHHHHHHccEEEEHHHHHHHHHHTTcHHHHHHHHHHHTTccccHHHHHHHHHHHHHTTTTTcccEHHHHHHHHTccccEEEEEEccHHHHHHHHcHHHHHHHHTTcccGGGcHHHHHHHHHHHHHHHHHHHEccccHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 186-187| PSIPRED cccccccccccccEEEEccccccHHHHHHHHHHHHccEEEEcHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEccccEEccHHHHHHHHHccEEEEEEccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHcccccccc //