[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : carA
DDBJ      :carA         arginine-specific carbamoyl-phosphate synthetase (small subunit)
Swiss-Prot:CARX_BACSU   RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain;         EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain;

Homologs  Archaea  60/68 : Bacteria  824/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.8.3
:353 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->348 1jdbF PDBj 5e-64 39.9 %
:RPS:PDB   1->348 1a9xB PDBj 2e-80 37.2 %
:RPS:SCOP  4->141 1a9xB1  c.8.3.1 * 2e-55 40.6 %
:RPS:SCOP  153->348 1a9xB2  c.23.16.1 * 4e-54 39.0 %
:HMM:SCOP  1->149 1a9xB1 c.8.3.1 * 1.4e-48 43.6 %
:HMM:SCOP  138->349 1a9xB2 c.23.16.1 * 5.8e-55 34.6 %
:RPS:PFM   2->125 PF00988 * CPSase_sm_chain 6e-36 54.8 %
:RPS:PFM   165->337 PF00117 * GATase 4e-19 37.1 %
:HMM:PFM   1->129 PF00988 * CPSase_sm_chain 3e-55 55.0 129/131  
:HMM:PFM   166->341 PF00117 * GATase 2.4e-49 35.2 176/192  
:BLT:SWISS 1->353 CARX_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12964.2 GT:GENE carA GT:PRODUCT arginine-specific carbamoyl-phosphate synthetase (small subunit) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1199327..1200388 GB:FROM 1199327 GB:TO 1200388 GB:DIRECTION + GB:GENE carA GB:PRODUCT arginine-specific carbamoyl-phosphate synthetase (small subunit) GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 1116335, 216664, 230177; Product type e: enzyme GB:PROTEIN_ID CAB12964.2 GB:DB_XREF GOA:P36838 HSSP:1M6V InterPro:IPR000991 SubtiList:BG10195 UniProtKB/Swiss-Prot:P36838 GB:GENE:GENE carA LENGTH 353 SQ:AASEQ MEGYLVLEDGTSFSGELDGHENCTGEAVFFTGMTGYQEVLTDPSYKGQIIVFTYPLIGNYGINEKDFESKKPQVKAAVVYEACDHFSHYEAVYSLKEYLQKWNIPLLTHVDTRAVVKKIRANGTMGATVTASKEGAEIALQPENVAEQASAQEISTFGDGNKHIALIDFGYKKSIASSLVKRGCKVTVVPYQQMEAVYNIKPDGIVLSNGPGDPKAIQPYLGKIKSIISRFPTLGICLGHQLIALAFGGNTFKLPFGHRGANHPVIDRKTKRVFMTSQNHSYVVDEQSINEEELTIRFHHVNDTSVEGLAHKKLPVMSVQFHPEAHPGPAESEWIFDDYLKNVIPARREIAHA GT:EXON 1|1-353:0| SW:ID CARX_BACSU SW:DE RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; EC=6.3.5.5;AltName: Full=Carbamoyl-phosphate synthetase glutamine chain; SW:GN Name=carA; Synonyms=cpaA; OrderedLocusNames=BSU11230; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Glutamine amidotransferase; Ligase;Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->353|CARX_BACSU|0.0|100.0|353/353| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 5->348|1jdbF|5e-64|39.9|343/380| RP:PDB:NREP 1 RP:PDB:REP 1->348|1a9xB|2e-80|37.2|347/378| RP:PFM:NREP 2 RP:PFM:REP 2->125|PF00988|6e-36|54.8|124/131|CPSase_sm_chain| RP:PFM:REP 165->337|PF00117|4e-19|37.1|167/185|GATase| HM:PFM:NREP 2 HM:PFM:REP 1->129|PF00988|3e-55|55.0|129/131|CPSase_sm_chain| HM:PFM:REP 166->341|PF00117|2.4e-49|35.2|176/192|GATase| GO:PFM:NREP 3 GO:PFM GO:0004086|"GO:carbamoyl-phosphate synthase activity"|PF00988|IPR002474| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00988|IPR002474| GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 2 RP:SCP:REP 4->141|1a9xB1|2e-55|40.6|138/151|c.8.3.1| RP:SCP:REP 153->348|1a9xB2|4e-54|39.0|195/228|c.23.16.1| HM:SCP:REP 1->149|1a9xB1|1.4e-48|43.6|149/151|c.8.3.1|1/1|Carbamoyl phosphate synthetase, small subunit N-terminal domain| HM:SCP:REP 138->349|1a9xB2|5.8e-55|34.6|211/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 2096 OP:NHOMOORG 1075 OP:PATTERN 11-1-12222222222-222222131111222221333222222222213222112--1-1111--22 2212211211122222211-12112111111222221232222211112111111122111211112221111111111-1122212211122122-1121211121121--------------122222222122222222222222222222222222222222145322222222222222122222123333333333233333333333333333334433332323212222223222222222212121411432223322111222311112222222222222222222222222222222222211222111134-23---111-1-1233322222-3-12123244322111323223-31222211111111222111111111122222222222-33333332223122222222222222212211222222222222222222122221111111111---------------111121211222221222222322222222222222222222222222222222221121222222222222222222222123321111111111222222222222231222222122222111111111113333222221222222222111211222212122221-1222211111111122122222222222-22222222222222222222222222222222222222222221222222221222222222222112222122333322223---1-31-1--1-1122222322222222222223222222222111121121212222222222212222222222222221121332222----1---------------------------------2--21222221 11--113-311-2221223222222222222222222322232222222222222222222222222212222222213222222222-22222232223221343-22143322322122222432216H2-3221122212211221222122322213-13211211611412222V2222232552732243222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 99.7 SQ:SECSTR cEEEEEETTccEEEEEEccccEEEEEEEEEcccccHHHHHTcGGGcTEEEEEccccccTTcccGGGcccccccccEEEccccccccccTTccccHHHHHHHTTcEEEEcccHHHHHHHHHHHccEEEEEEEcccccHHHHHHHccHHHHcccccEEEccccEEEEEEEccccHHHHHHHHHTTEEEEEEETTcHHHHHTTcccEEEEcccccccTTcHHHHHHHHHHTTccccEEEEHHHHHHHHHTTccEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEccTTcTcTTEEEEEEETTTccEEEEEEccccEEEEcccTTccccccTTTHHHHHHHHHHHHHHHHHHc# DISOP:02AL 353-354| PSIPRED ccEEEEEccccEEEEEEEcccccEEEEEEEccccccccccccHHcccEEEEEcccccccccccHHHHcccccEEEEEEEcccccccccccccccHHHHHHHccccEEEcccHHHHHHHHHHcccccEEEEccccccccccccccccccccccccEEccccccEEEEEEcccHHHHHHHHHHcccEEEEEEcccHHHHHHccccEEEEccccccHHHcccHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEccccccccccEEEEccccEEEEEccccEEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccc //