[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cheR
DDBJ      :cheR         methyl-accepting chemotaxis proteins (MCPs) methyltransferase
Swiss-Prot:CHER_BACSU   RecName: Full=Chemotaxis protein methyltransferase;         EC=2.1.1.80;

Homologs  Archaea  26/68 : Bacteria  494/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.58.1c.66.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->239 1bc5A PDBj 3e-27 32.6 %
:RPS:PDB   2->255 1af7A PDBj 1e-34 28.4 %
:RPS:SCOP  2->65 1af7A1  a.58.1.1 * 5e-08 20.3 %
:RPS:SCOP  67->239 1af7A2  c.66.1.8 * 2e-54 34.1 %
:HMM:SCOP  2->66 1af7A1 a.58.1.1 * 1.3e-09 32.3 %
:HMM:SCOP  67->256 1af7A2 c.66.1.8 * 1.4e-51 37.6 %
:RPS:PFM   13->56 PF03705 * CheR_N 3e-04 43.2 %
:RPS:PFM   67->237 PF01739 * CheR 5e-41 49.1 %
:HMM:PFM   67->252 PF01739 * CheR 5.3e-69 48.4 186/196  
:HMM:PFM   3->55 PF03705 * CheR_N 1.8e-15 35.8 53/57  
:BLT:SWISS 1->256 CHER_BACSU e-147 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14188.2 GT:GENE cheR GT:PRODUCT methyl-accepting chemotaxis proteins (MCPs) methyltransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2380347..2381117) GB:FROM 2380347 GB:TO 2381117 GB:DIRECTION - GB:GENE cheR GB:PRODUCT methyl-accepting chemotaxis proteins (MCPs) methyltransferase GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10196193, 15544802, 7635819, 7893679, 8244966; Product type e: enzyme GB:PROTEIN_ID CAB14188.2 GB:DB_XREF GOA:P31105 InterPro:IPR000780 SubtiList:BG10283 UniProtKB/Swiss-Prot:P31105 GB:GENE:GENE cheR LENGTH 256 SQ:AASEQ MDTYSVFTTKWKQLTGVDLTLYKEAQMKRRLTSLYEKKGFQSFKDFAAALEKDQALLNETLDRMTINVSEFYRNYKRWEVLETAILPLIKTSRPLKIWSAACSTGEEPYTLAMLLDQQKGLPGYQILATDIDEKALEKAKKGVYQERSLQEVPLSVKDRYFTQNANRSYEVKTEIKKNITFKKHNLLADRYEQDFDLIVCRNVFIYFTESAKEELYLKMAHSLKKNGVLFVGSTEQIFNPEKFGLVPADTFFYQKR GT:EXON 1|1-256:0| SW:ID CHER_BACSU SW:DE RecName: Full=Chemotaxis protein methyltransferase; EC=2.1.1.80; SW:GN Name=cheR; OrderedLocusNames=BSU22720; SW:KW Chemotaxis; Complete proteome; Methyltransferase;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|CHER_BACSU|e-147|100.0|256/256| GO:SWS:NREP 3 GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 13->239|1bc5A|3e-27|32.6|224/269| RP:PDB:NREP 1 RP:PDB:REP 2->255|1af7A|1e-34|28.4|250/274| RP:PFM:NREP 2 RP:PFM:REP 13->56|PF03705|3e-04|43.2|44/57|CheR_N| RP:PFM:REP 67->237|PF01739|5e-41|49.1|169/195|CheR| HM:PFM:NREP 2 HM:PFM:REP 67->252|PF01739|5.3e-69|48.4|186/196|CheR| HM:PFM:REP 3->55|PF03705|1.8e-15|35.8|53/57|CheR_N| GO:PFM:NREP 2 GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF03705|IPR000780| GO:PFM GO:0008757|"GO:S-adenosylmethionine-dependent methyltransferase activity"|PF01739|IPR000780| RP:SCP:NREP 2 RP:SCP:REP 2->65|1af7A1|5e-08|20.3|64/81|a.58.1.1| RP:SCP:REP 67->239|1af7A2|2e-54|34.1|170/193|c.66.1.8| HM:SCP:REP 2->66|1af7A1|1.3e-09|32.3|65/81|a.58.1.1|1/1|Chemotaxis receptor methyltransferase CheR, N-terminal domain| HM:SCP:REP 67->256|1af7A2|1.4e-51|37.6|186/193|c.66.1.8|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 1070 OP:NHOMOORG 523 OP:PATTERN -----------------------11111-111---1--1111133-13-2422-1-1-11-------- 1221-----------11----1---1--------------2---2---1-------------1-1---------------1---12-------------1-1-2-52423-----------------111---21-22222---11112122--------------32231------------2-------211222222221222222111121222111111111111113------------------------------------------------------------------------------------------31123111111111111111---115--11131114213212111221--2124334-----3135631144225----------1-2242244721--1113322223531-211-2-444425---------22211734------------------------------1-211211-12223324222144352223132243422--11231422221421123121242-------1112232822215318633219AA7849256666962-1111-1111-1-1-------21-5---32-224111142222221122212311133---2241------11111111111111111-1111111111111111111---111111111111111111111111-1111--111111111111---1---------22512----------------------11-1444444335334334444-----1---1111233333111332244444333------621122222222222211--------------------------2-12211111-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 255 STR:RPRED 99.6 SQ:SECSTR #HHHHHHHHHHHHHHcccccGGGHHHHHHHHHHHHHHHTcccHHHHHHHHHTTcTHHHHHHHHHccccccTTTTTTHHHHHHHHHHHcHHHcccEEEEEcccTTTHHHHHHHHHHHHHHccTcEEEEEEEccHHHHHHHHHTEEEGGGGTTccHHHHHHHEEEccTTcccEcHHHHTTEEEEEccTTcccccccEEEEEEcccGGGccHHHHHHHHHHHGGGEEEEEEEEEcTTcccTTTcTTTEEEEETTEEEEH DISOP:02AL 256-257| PSIPRED ccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHcccccHHHHccccHHHHHHHccccccccEEEcHHHHHccEEcccccccccccccccEEEEcHHHHHccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccEEEcc //