[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cheV
DDBJ      :cheV         coupling protein and response regulator for CheA activity in response to attractants (chemotaxis)
Swiss-Prot:CHEV_BACSU   RecName: Full=Chemotaxis protein cheV;

Homologs  Archaea  17/68 : Bacteria  444/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
b.40.7c.23.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->142 2qdlB PDBj 2e-17 32.8 %
:BLT:PDB   176->288 3gt7A PDBj 2e-11 37.9 %
:RPS:PDB   16->153 2ch4W PDBj 1e-25 28.5 %
:RPS:PDB   176->301 3cu5A PDBj 3e-13 18.9 %
:RPS:SCOP  16->153 2ch4W1  b.40.7.1 * 5e-26 28.5 %
:RPS:SCOP  176->297 1a0oA  c.23.1.1 * 2e-19 27.4 %
:HMM:SCOP  7->153 1k0sA_ b.40.7.1 * 1.2e-32 30.1 %
:HMM:SCOP  172->301 1s8nA_ c.23.1.1 * 2.2e-23 28.8 %
:RPS:PFM   22->149 PF01584 * CheW 3e-15 33.1 %
:RPS:PFM   177->288 PF00072 * Response_reg 2e-07 35.0 %
:HMM:PFM   19->152 PF01584 * CheW 1.5e-36 32.1 134/138  
:HMM:PFM   177->297 PF00072 * Response_reg 1.1e-29 33.6 110/112  
:BLT:SWISS 1->303 CHEV_BACSU e-173 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13274.1 GT:GENE cheV GT:PRODUCT coupling protein and response regulator for CheA activity in response to attractants (chemotaxis) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1473605..1474516 GB:FROM 1473605 GB:TO 1474516 GB:DIRECTION + GB:GENE cheV GB:PRODUCT coupling protein and response regulator for CheA activity in response to attractants (chemotaxis) GB:FUNCTION 16.3: Control 16.12: Sense GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11553614, 12864845, 14731274, 14993307; Product type r: regulator GB:PROTEIN_ID CAB13274.1 GB:DB_XREF GOA:P37599 HSSP:1MB3 InterPro:IPR001789 SubtiList:BG10823 UniProtKB/Swiss-Prot:P37599 GB:GENE:GENE cheV LENGTH 303 SQ:AASEQ MSLQQYEILLDSGTNELEIVKFGVGENAFGINVMKVREIIQPVEVTSVPHSHQHVEGMIKLRGEILPVISLFSFFGVEPEGSKDEKYIVTEFNKRKIVFHVGSVSQIHRVSWEAIEKPTSLNQGMERHLTGIIKLEDLMIFLPDYEKIIYDIESDSGVDTYNMHTEGFDERRTDKKLIIVEDSPLLMRLLQDELKEAGYNNIASFENGKEAYEYIMNLAENETDLSKQIDMIITDIEMPKMDGHRLTKLLKENPKSSDVPVMIFSSLITDDLRHRGEVVGADEQISKPEISDLIKKVDTYVIE GT:EXON 1|1-303:0| SW:ID CHEV_BACSU SW:DE RecName: Full=Chemotaxis protein cheV; SW:GN Name=cheV; OrderedLocusNames=BSU14010; SW:KW Chemotaxis; Complete proteome; Phosphoprotein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->303|CHEV_BACSU|e-173|100.0|303/303| GO:SWS:NREP 1 GO:SWS GO:0006935|"GO:chemotaxis"|Chemotaxis| BL:PDB:NREP 2 BL:PDB:REP 18->142|2qdlB|2e-17|32.8|125/146| BL:PDB:REP 176->288|3gt7A|2e-11|37.9|103/132| RP:PDB:NREP 2 RP:PDB:REP 16->153|2ch4W|1e-25|28.5|137/139| RP:PDB:REP 176->301|3cu5A|3e-13|18.9|111/124| RP:PFM:NREP 2 RP:PFM:REP 22->149|PF01584|3e-15|33.1|127/135|CheW| RP:PFM:REP 177->288|PF00072|2e-07|35.0|100/111|Response_reg| HM:PFM:NREP 2 HM:PFM:REP 19->152|PF01584|1.5e-36|32.1|134/138|CheW| HM:PFM:REP 177->297|PF00072|1.1e-29|33.6|110/112|Response_reg| GO:PFM:NREP 7 GO:PFM GO:0004871|"GO:signal transducer activity"|PF01584|IPR002545| GO:PFM GO:0005622|"GO:intracellular"|PF01584|IPR002545| GO:PFM GO:0006935|"GO:chemotaxis"|PF01584|IPR002545| GO:PFM GO:0007165|"GO:signal transduction"|PF01584|IPR002545| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 2 RP:SCP:REP 16->153|2ch4W1|5e-26|28.5|137/139|b.40.7.1| RP:SCP:REP 176->297|1a0oA|2e-19|27.4|113/128|c.23.1.1| HM:SCP:REP 7->153|1k0sA_|1.2e-32|30.1|146/0|b.40.7.1|1/1|CheW-like| HM:SCP:REP 172->301|1s8nA_|2.2e-23|28.8|118/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 1164 OP:NHOMOORG 483 OP:PATTERN -----------------------1------1----1--1---215-17-2324-1-1-11-------- -11-------------------------------------2-------------------------------------------2322--33-2------14-11---21------------------1-----1-11154---1-443445124-1---1-12-4-7773-------------1---2---211131222212222222311112221--1-1211121212--------------------1111--1-1111111--1-1--------------11----------------------------------5352633333231423-122111213--2115355322321213224---26-111--------1221113111211111111111---------1-1-333344444434--21--1-121-11---------1111-111---11--------111--1--1--1--11---1-1-----------3------32-----1--12425--1111211121-4-22-21-1146-------11--36-91221255C844539A9698A26-1--33412333-22222244444444436421--55-531222214566633344343533445--1-523------2112-11-----------------------------11111112-2222222222222222----------211111111111---------------6-4---------------11--1-111--222224557355553544---------2444466666554552211111112------61111111211-11-1----------------------------1122132332--- ----------------1-----------------------------111-1121---11111-1-----1----------------------1-----------------------------------------------------------------1--------------1----1A--------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 294 STR:RPRED 97.0 SQ:SECSTR #########ccccccEEEEEEEEcTTccEEEcTTTEEEEEEcccccccccccTTEEEEEEETTEEEEEEEHHHHHTccccTTTccEEEEEEccccEEEEEEcEEEEEEEEETTTcccccTTTcccTTTEEEEccccccccEEEcHHHHHHHHHHHHHHHHHTHHHHcccEEEEccEEEEEcccHHHHHHHHHHccGGGccccEEEEEEccHHHHHHHHTTccccHHTcccEEEEEcccccccHHHHHHHHHHHcTTcEEEEEccEccccHHHcTTTccccccEEEccccHHHHHHHHHHHHEH DISOP:02AL 1-4, 114-123, 161-170| PSIPRED cccccccEEEcccccEEEEEEEEEccEEEEccHHHEEEEEcccccccccccccccEEEEEEcccEEEEEEHHHHcccccccccccEEEEEEEccEEEEEEEEEEEEEEEEcHHHHcccccccccccEEEEEEEEEcccEEEEEEHHHHHHHHHcccccccccHHHHcccccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHHHcHHHccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHcc //